HomeText SearchStructure Searche-Chemicals.comList Your CompanyContactAccountLogoff






























Nanjing Peptide Biotech Ltd.




Country: China

Nanjing Peptide Biotech Ltd.
Floor 3,158 Fangshui Road
Nanjing
China


Phone: 86-25-58361106-805
FAX: 86-25-58361106-806
E-Mail:E-Mail this Supplier

Contact: Gary Liu

http://www.njpeptide.com

Nanjing Peptides provide custom peptides for the productionof antibodies and labelled peptides for assay development.

Additionally, we have the capacity and expertise to synthesize a large and diverse range of peptides. This is done with dedication to providing high quality products with fast turnaround times.


Product List: 11,481

PON:Page:1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 |


 


Product List

((CYS31,NVA34)-NEUROPEPTIDE Y (27-36))2
CAS:172997-92-1
(+)-(1R,4S)-N-BOC-4-AMINOCYCLOPENT-2-ENECARBOXYLIC ACID
CAS:151907-80-1
(+)-(1S,3R)-3-AMINOCYCLOPENTANECARBOXYLIC ACID
CAS:71830-07-4
(+)-(1S,3R)-N-BOC-3-AMINOCYCLOPENTANECARBOXYLIC ACID
CAS:261165-05-3
(+)-(1S,3R)-N-FMOC-3-AMINOCYCLOPENTANECARBOXYLIC ACID
CAS:220497-66-5
(+)-(8,8-DICHLOROCAMPHORYLSULFONYL)OXAZIRIDINE
CAS:127184-05-8
([15N]GLY)-GLUTATHIONE
([15N]GLY)-GLUTATHIONE (REDUCED)
([D8]VAL7·10)-C-PEPTIDE (HUMAN)
(1-ADAMANTANEACETYL1,D-TYR(ET)2,VAL4,ABU6, ARG8·9)-VASOPRESSIN
(1-ADAMANTANECARBONYL-D-ARG0,HYP3,SS-(2-THIENYL)-ALA5·8,D-PHE7)-BRADYKININ
(1-FMOC-AMINO-CYCLOPENTYL)-ACETIC ACID
CAS:282524-99-6
(1H-PYRROLO[3,2-B]PYRIDIN-6-YL)METHANOL
CAS:1015609-51-4
(2,3-DIHYDRO-[1,4]DIOXINO[2,3-B]PYRIDIN-7-YL)METHANOL
CAS:443956-46-5
(2R,3R)-3-AMINO-3-(4-FLUOROPHENYL)-2-HYDROXY-PROPIONIC ACID
CAS:55652-55-6
(2S,3S)-3-AMINO-2-HYDROXY-3-(3,5-DIMETHOXY-PHENYL)-PROPIONIC ACID
CAS:959576-14-8
(2S,3S)-3-AMINO-3-(4-FLUORO-PHENYL)-2-HYDROXY-PROPIONIC ACID
CAS:55652-55-6
(3,4-DEHYDRO-PRO-NH23)-TRH
(3,4-DEHYDRO-PRO2·3)-BRADYKININ
(3,4-DEHYDRO-PRO2·3,DES-ARG9)-BRADYKININ
(3,4-DEHYDRO-PRO2·4)-SUBSTANCE P
CAS:87367-30-4
(3,4-DEHYDRO-PRO3)-TUFTSIN
CAS:91502-65-7
(3,5-DIBROMO-TYR1)-LEU-ENKEPHALIN
(3-(4-AZIDOPHENYL)PROPIONYL1,D-TYR(ME)2,ARG6,ARG8,TYR-NH29)-VASOPRESSIN
CAS:157702-46-0
(4-((2-METHYLPHENYL)AMINOCARBONYL)-AMINOPHENYL)ACETYL-FIBRONECTIN CS-1 FRAGMENT (1980-1983)
(4-(4-AZIDOPHENYL)BUTYRYL1,D-TYR(ME)2,ARG6,ARG8,TYR-NH29)-VASOPRESSIN
(7-DIETHYLAMINOCOUMARIN-3-YL)CARBONYL-AMYLOID SS-PROTEIN (1-40)
(ABZ-GLY1)-GALANIN (1-10)-LYS(RETRO-M-NITRO-TYR-H) AMIDE (HUMAN)
(ALA1·3·11·15)-ENDOTHELIN-1
CAS:121204-87-3
(ALA11,D-LEU15)-OREXIN B (HUMAN)
CAS:532932-99-3
(ALA11·22·28)-VIP (HUMAN, BOVINE, PORCINE, RAT)
CAS:291524-04-4
(ALA13)-APELIN-13 (HUMAN, BOVINE, MOUSE, RAT)
CAS:568565-11-7
(ALA2)-LEU-ENKEPHALIN
(ALA22)-STICHODACTYLA HELIANTHUS NEUROTOXIN (SHK)
(ALA31,AIB32)-NEUROPEPTIDE Y (PORCINE)
CAS:313988-59-9
(ALA6,D-TRP8,L-ALANINOL15)-GALANIN (1-15)
CAS:184683-37-2
(ALA92)-PEPTIDE 6
CAS:189064-08-2
(ALA96)-MYELIN BASIC PROTEIN (87-99) (HUMAN, BOVINE, RAT)
(ARG)7
(ARG)9, FAM-LABELED;FAM-RRRRRRRRR
(ARG)9, TAMRA-LABELED;TAMRA-RRRRRRRRR
(ARG)9;RRRRRRRRR
CAS:143413-47-2
(ARG17)-AMYLOID SS-PROTEIN (1-42)
(ARG22)-STICHODACTYLA HELIANTHUS NEUROTOXIN (SHK)
(ARG6,SS-CYCLOHEXYL-ALA8,D-TIC16,ARG17,CYS18)-ATRIAL NATRIURETIC FACTOR (6-18) AMIDE (MOUSE, RABBIT, RAT)
(ARG8)-CONOPRESSIN G
CAS:130836-24-7
(ARG8)-VASOPRESSIN
CAS:113-79-1
(ARG8)-VASOPRESSIN (FREE ACID)
CAS:25255-33-8
(ASN(4-AMINOBUTYL)1·7·23,GLN(4-AMINOBUTYL)3·11·22)-AMYLOID SS-PROTEIN (1-40)
(ASN1,VAL5)-ANGIOTENSIN II
CAS:53-73-6
(ASN370) TYROSINASE (368–376)?? ;YMNGTMSQV
(ASN5)-DELTA-SLEEP INDUCING PEPTIDE
CAS:80064-67-1
(ASN670,STA671,VAL672)-AMYLOID SS/A4 PROTEIN PRECURSOR770 (662-675)
(ASP371)-TYROSINASE (369-377) (HUMAN)
CAS:168650-46-2
(ASP56)-PTH (1-84) (RAT)
CAS:89899-56-9
(ASP76)-PTH (39-84) (HUMAN)
CAS:79804-72-1
(BOC-CYS-OH)2
CAS:10389-65-8
(BOC-TYR1,D-ALA2)-LEU-ENKEPHALIN-LYS
CAS:183663-89-0
(CIT5)-TRAP-5
CAS:287184-84-3
(CYCLO(GLU22-LYS26),LEU27)-PTH (1-31) AMIDE (HUMAN)
CAS:188899-65-2
(CYS(ACM)2·7)-A-CGRP (HUMAN)
(CYS(ACM)33)-ENDOSTATIN (6-49) (HUMAN)
(CYS(BZL)84)-CD4 (81-92)
CAS:123380-68-7
(CYS(BZL)84,GLU(OBZL)85)-CD4 (81-92)
(CYS(ET)2·7)-A-CGRP (HUMAN)
(CYS-ANTENNAPEDIA HOMEOBOX (43-58) AMIDE)-(CYS-FLAG-COFILIN (1-13) (HUMAN, MOUSE, PORCINE, RAT))
(CYS0)-GTP-BINDING PROTEIN GSA (28-42)
(CYS18)-ATRIAL NATRIURETIC FACTOR (4-18) AMIDE (MOUSE, RABBIT, RAT)
(CYS2)-NEUROPEPTIDE Y (1-4)-8-AMINOOCTANOYL-(D-CYS27)-NEUROPEPTIDE Y (25-32)
CAS:128806-04-2
(CYS39)-TISSUE FACTOR (33-53)
CAS:313642-01-2
(CYS8)-PTH (1-8) (HUMAN)
CAS:844499-32-7
(CYS935)-FOCAL ADHESION KINASE 1 (921-935) AMIDE (HUMAN)
(D(CH2)51,D-ILE2,ILE4,ARG8)-VASOPRESSIN
CAS:88686-53-7
(D(CH2)51,D-ILE2,ILE4,ARG8,ALA-NH29)-VASOPRESSIN
CAS:114455-29-7
(D(CH2)51,D-PHE2,ILE4,ALA-NH29)-VASOPRESSIN
(D(CH2)51,D-TYR(ET)2,VAL4,ARG8,DES-GLY9)-VASOPRESSIN
CAS:90332-82-4
(D(CH2)51,D-TYR(ME)2,VAL4,ARG8)-VASOPRESSIN
(D(CH2)51,TYR(ET)2,VAL4,ARG8)-VASOPRESSIN
CAS:77453-01-1
(D(CH2)51,TYR(ET)2,VAL4,ARG8,DES-GLY-NH29)-VASOPRESSIN
CAS:110567-67-4
(D(CH2)51,TYR(ET)2,VAL4,ARG8,DES-GLY9)-VASOPRESSIN
CAS:90332-81-3
(D(CH2)51,TYR(ME)2,THR4,ORN8,DES-GLY-NH29)-VASOTOCIN
(D(CH2)51,TYR(ME)2,THR4,ORN8,TYR-NH29)-VASOTOCIN
(D-2-NAL5,CYS6
CAS:111857-96-6
(D-2-NAL5,CYS6·11,TYR7,D-TRP8,VAL10,2-NAL12)-SOMATOSTATIN-14 (5-12) AMIDE
CAS:111857-96-6
(D-2-NAL6)-LHRH
CAS:76932-56-4
(D-ALA1)-PEPTIDE T
CAS:106362-33-8
(D-ALA2)-GRF (1-29) AMIDE (HUMAN)
CAS:89453-59-8
(D-ALA2)-SS-CASOMORPHIN (1-3) AMIDE
(D-ALA2)-SS-CASOMORPHIN (1-4) AMIDE (BOVINE)
(D-ALA2)-SS-CASOMORPHIN (1-5) AMIDE (BOVINE)
(D-ALA2,D-ARG6)-DYNORPHIN A (1-13)
(D-ALA2,D-LEU5)-ENKEPHALIN AMIDE
CAS:66609-26-5
(D-ALA2,HYP4,TYR5)-SS-CASOMORPHIN (1-5) AMIDE
(D-ALA2,HYP4,TYR5)-SS-CASOMORPHIN (1-5) AMIDE
CAS:102029-98-1
(D-ALA2,MET5)-SS-CASOMORPHIN (1-5) AMIDE (BOVINE)
(D-ALA2,N-ME-PHE4,METHIONIN(O)-OL5)-ENKEPHALIN
(D-ALA3)-DYNORPHIN A (1-11) AMIDE
CAS:160522-58-7
(D-ALA7)-ANGIOTENSIN I/II (1-7)
CAS:159432-28-7
(D-ARG0,HYP3,D-PHE7)-BRADYKININ
CAS:109333-26-8
(D-ARG0,HYP3,D-PHE7,LEU8)-BRADYKININ
CAS:135701-67-6
(D-ARG0,HYP3,SS-(2-THIENYL)-ALA5·8,D-PHE7)-BRADYKININ
(D-ARG1,D-PHE5,D-TRP7·9,LEU11)-SUBSTANCE P
CAS:96736-12-8
(D-ARG1,D-PRO2,D-PHE7,D-HIS9)-SUBSTANCE P
CAS:115760-58-2
(D-ARG1,D-TRP7·9,LEU11)-SUBSTANCE P
CAS:91224-37-2
(D-ARG2)-KYOTORPHIN
CAS:70904-57-3
(D-ARG2,LYS4)-DERMORPHIN (1-4) AMIDE
CAS:118476-85-0
(D-ARG2,SAR4)-DERMORPHIN (1-4)
CAS:90549-86-3
(D-ARG6)-DYNORPHIN A (1-13)
CAS:75921-87-8
(D-ARG6,AZAGLY10)-LHRH II (HUMAN, CHICKEN)
CAS:335380-72-8
(D-ARG8)-DYNORPHIN A (1-13)
CAS:125357-12-2
(D-ASP1)-AMYLOID SS-PROTEIN (1-42)
(D-BPA13,TYR19)-MCH (HUMAN, MOUSE, RAT)
CAS:183606-10-2
(D-CYS(TBU)2,THR(TBU)6)-LEU-ENKEPHALIN-THR
(D-GLU5,D-TRP7·9·10)-SUBSTANCE P (5-11)
CAS:289632-61-7
(D-HIS(BZL)6)-LHRH (1-7) (FREE ACID)
(D-HIS(BZL)6,PRO-NHET9)-LHRH (2-9)
CAS:134190-11-7
(D-HIS(BZL)6,PRO-NHET9)-LHRH (3-9)
(D-HIS(BZL)6,PRO-NHET9)-LHRH (4-9)
CAS:134009-09-9
(D-HIS(BZL)6,PRO-NHET9)-LHRH (5-9)
(D-HIS2,D-SER(TBU)6,AZAGLY10)-LHRH
(D-HIS2,D-TRP6)-LHRH
CAS:321709-34-6
(D-LEU2)-MELANOCYTE-STIMULATING HORMONE-RELEASE INHIBITING FACTOR
CAS:39705-60-7
(D-LEU6)-LHRH (1-8) (FREE ACID)
(D-LEU6,PRO-NHET9)-LHRH (4-9)
CAS:202333-85-5
(D-LEU7)-LHRH
CAS:53728-75-9
(D-LYS(NICOTINOYL)1,SS-(3-PYRIDYL)-ALA3,3,4-DICHLORO-D-PHE5,ASN6,D-TRP7,SS-(3-PYRIDYL)-D-ALA9,NLE11)-SUBSTANCE P
CAS:154427-06-2
(D-LYS(NICOTINOYL)1,SS-(3-PYRIDYL)-ALA3,3,4-DICHLORO-D-PHE5,ASN6,D-TRP7·9,NLE11)-SUBSTANCE P
(D-LYS16)-ACTH (1-24) (HUMAN, BOVINE, MOUSE, OVINE, PORCINE, RABBIT, RAT)
(D-LYS6)-LHRH (FREE ACID)
CAS:214061-18-4
(D-PEN2,P-CHLORO-PHE4,D-PEN5)-ENKEPHALIN
CAS:122507-47-5
(D-PEN2,PEN5)-ENKEPHALIN
CAS:88373-72-2
(D-PHE12)-BOMBESIN
CAS:108437-87-2
(D-PHE12,NLE21·38)-CRF (12-41) (HUMAN, RAT)
CAS:129133-27-3
(D-PHE12,NLE21·38,A-ME-LEU37)-CRF (12-41) (HUMAN, RAT)
(D-PHE2)-VIP (HUMAN, BOVINE, PORCINE, RAT)
CAS:104051-15-2
(D-PHE2·6,PRO3)-LHRH
CAS:67019-15-2
(D-PHE5,CYS6
CAS:340821-13-8
(D-PHE5,CYS6·11,N-ME-D-TRP8)-SOMATOSTATIN-14 (5-12) AMIDE
CAS:340821-13-8
(D-PHE6,LEU-NHET13,DES-MET14)-BOMBESIN (6-14)
CAS:124199-90-2
(D-PHE6,LEU13-(?)-P-CHLORO-PHE14)-BOMBESIN (6-14)
(D-PRO12)-A-MSH (11-13) (FREE ACID)
(D-PRO194)-IL-1SS (193-195) (HUMAN)
(D-PRO194)-IL-1SS (193-195) (HUMAN)
CAS:117027-34-6
(D-PRO2)-SS-CASOMORPHIN (1-5) (BOVINE)
(D-PRO2,D-TRP7·9)-SUBSTANCE P
CAS:80434-86-2
(D-PRO4,D-TRP7·9,NLE11)-SUBSTANCE P (4-11)
CAS:89430-34-2
(D-PRO4,D-TRP7·9·10)-SUBSTANCE P (4-11)
CAS:86917-57-9
(D-SER(TBU)6,D-LEU7,AZAGLY10)-LHRH
(D-SER1)-ACTH (1-24) (HUMAN, BOVINE, MOUSE, OVINE, PORCINE, RABBIT, RAT)
CAS:26469-81-8
(D-SER4)-LHRH
CAS:103065-82-3
(D-SER4,D-SER(TBU)6,AZAGLY10)-LHRH
(D-SER4,D-TRP6)-LHRH
CAS:102992-39-2
(D-SER6,AZAGLY10)-LHRH
CAS:65807-03-6
(D-THR6,D-TRP8·9,L-ALANINOL15)-GALANIN (1-15)
CAS:150940-97-9
(D-TRP12,TYR34)-PTH (7-34) AMIDE (BOVINE)
CAS:118102-98-0
(D-TRP2)-GALANIN (1-29) (HUMAN)
(D-TRP32)-NEUROPEPTIDE Y (HUMAN, RAT)
CAS:178861-83-1
(D-TRP32)-NEUROPEPTIDE Y (PORCINE)
CAS:153549-78-1
(D-TRP6)-LHRH (1-6) AMIDE
(D-TRP6)-LHRH (2-10)
(D-TRP6)-LHRH (FREE ACID)
CAS:129418-54-8
(D-TRP6)-LHRH-LEU-ARG-PRO-GLY AMIDE
(D-TRP6,D-LEU7)-LHRH
CAS:321709-37-9
(D-TRP7,ALA8,D-PHE10)-A-MSH (6-11) AMIDE
(D-TRP8)-SOMATOSTATIN-14
CAS:58976-46-8
(D-TRP8,D-CYS14)-SOMATOSTATIN-14
CAS:61950-59-2
(D-TYR1,N-ME-PHE3)-NEUROPEPTIDE FF
CAS:145274-93-7
(D-TYR11)-NEUROTENSIN
CAS:64088-62-6
(D-TYR27·36,D-THR32)-NEUROPEPTIDE Y (27-36)
CAS:163887-48-7
(D-TYR5,D-SER(TBU)6,AZAGLY10)-LHRH
(D-TYR5,D-TRP6)-LHRH
CAS:321709-35-7
(D-TYR6,SSPHE11,PHE13,NLE14)-BOMBESIN (6-14) (FREE ACID)
(D-VAL22)-BIG ENDOTHELIN-1 FRAGMENT (16-38) (HUMAN)
CAS:158884-64-1
(DAB7)-LEIUROTOXIN I
CAS:1061556-49-7
(DAB9)-NEUROTENSIN (8-13)
(DAP22)-STICHODACTYLA HELIANTHUS NEUROTOXIN (SHK)
CAS:220384-25-8
(DEAMINO-CYS1,D-ORN8)-VASOPRESSIN
(DEAMINO-CYS1,D-TYR(ET)2,THR4,ORN8)-OXYTOCIN
(DEAMINO-CYS1,LEU4,LYS8)-VASOPRESSIN
(DEAMINO-CYS1,LYS8)-VASOPRESSIN
CAS:2989-84-6
(DEAMINO-CYS1,SS-(3-PYRIDYL)-D-ALA2,ARG8)-VASOPRESSIN
(DEAMINO-CYS1,SS-CYCLOHEXYL-ALA4,ARG8)-VASOPRESSIN
(DEAMINO-CYS11,D-2-NAL14,CYS18)-SS-MSH (11-22) AMIDE
(DEAMINO-CYS3,NLE4,ARG5,D-2-NAL7,CYS11)-A-MSH (3-11) AMIDE
CAS:613222-50-7
(DEAMINO-PHE19,D-ALA24,D-PRO26-(?)-PHE27)-GRP (19-27) (HUMAN, PORCINE, CANINE)
(DES-ACETYL)-A-MSH
(DES-ARG9)-BRADYKININ
CAS:15958-92-6
(DES-ARG9,LEU8)-BRADYKININ
CAS:64695-06-3
(DES-ASP1)-ANGIOTENSIN I
CAS:56317-01-2
(DES-ASP1,ILE8)-ANGIOTENSIN II
CAS:52498-25-6
(DES-ASP187)-MELANOCYTE PROTEIN PMEL 17 (185-193) (HUMAN, BOVINE, MOUSE)
CAS:319927-23-6
(DES-ASP187,MET186)-MELANOCYTE PROTEIN PMEL 17 (185-193) (HUMAN, BOVINE, MOUSE)
CAS:255710-51-1
(DES-BROMO)-NEUROPEPTIDE B (1-23) (HUMAN)
CAS:434897-64-0
(DES-CYS1,CYCLO(SER2-ASU7))-CALCITONIN (EEL)
(DES-GLY)-GLUTATHIONE (REDUCED)
(DES-GLY)-GLUTATHIONE-MONOETHYL ESTER (REDUCED)
(DES-GLY10,D-ALA6,PRO-NHET9)-LHRH (SALMON)
CAS:88848-87-7
(DES-GLY10,D-ALA6,PRO-NHET9)-LHRH II (CHICKEN)
CAS:319432-42-3
(DES-GLY10,D-ARG6,PRO-NHET9)-LHRH (SALMON)
(DES-GLY10,D-ARG6,PRO-NHET9)-LHRH II (CHICKEN)
CAS:145940-57-4
(DES-GLY10,D-HIS(BZL)6,D-LEU7,PRO-NHET9)-LHRH
CAS:321709-43-7
(DES-GLY10,D-HIS2,D-HIS(BZL)6,PRO-NHET9)-LHRH
CAS:134009-10-2
(DES-GLY10,D-HIS2,D-LEU6,PRO-NHET9)-LHRH
CAS:112642-11-2
(DES-GLY10,D-HIS2,D-SER(TBU)6,PRO-NHET9)-LHRH
(DES-GLY10,D-HIS2,D-SER4,D-LEU6,PRO-NHET9)-LHRH
(DES-GLY10,D-HIS2,D-TRP6,PRO-NHET9)-LHRH
(DES-GLY10,D-LEU6,[13C6]LEU7,PRO-NHET9)-LHRH
(DES-GLY10,D-LEU6,D-LEU7,PRO-NHET9)-LHRH
CAS:112710-58-4
(DES-GLY10,D-LEU6,ORN8,PRO-NHET9)-LHRH
CAS:1051970-61-6
(DES-GLY10,D-PYR1,D-LEU6,PRO-NHET9)-LHRH
(DES-GLY10,D-PYR1,D-SER(TBU)6,PRO-NHET9)-LHRH
(DES-GLY10,D-SER(TBU)6,PRO-NHET9)-LHRH
CAS:68630-75-1
(DES-GLY10,D-SER(TBU)6,PRO-NHNH29)-LHRH
CAS:147688-42-4
(DES-GLY10,D-SER4,D-HIS(BZL)6,PRO-NHET9)-LHRH
CAS:134053-51-3
(DES-GLY10,D-SER4,D-LEU6,PRO-NHET9)-LHRH
CAS:62621-13-0
(DES-GLY10,D-SER4,D-SER(TBU)6,PRO-NHET9)-LHRH
(DES-GLY10,D-SER4,D-TRP6,PRO-NHET9)-LHRH
(DES-GLY10,D-TRP3,D-LEU6,PRO-NHET9)-LHRH
(DES-GLY10,D-TRP6,D-LEU7,PRO-NHET9)-LHRH
(DES-GLY10,D-TRP6,PRO-NHET9)-LHRH HIGH ACETATE SALT
(DES-GLY10,D-TYR5,D-HIS(BZL)6,PRO-NHET9)-LHRH
CAS:321709-40-4
(DES-GLY10,D-TYR5,D-LEU6,PRO-NHET9)-LHRH
CAS:112710-57-3
(DES-GLY10,D-TYR5,D-SER(TBU)6,PRO-NHET9)-LHRH
(DES-GLY10,D-TYR5,D-TRP6,PRO-NHET9)-LHRH
(DES-GLY10,DES-SER4,D-LEU6,PRO-NHET9)-LHRH
CAS:267878-61-5
(DES-GLY10,HIS(BZL)6,PRO-NHET9)-LHRH
CAS:76712-82-8
(DES-GLY10,LEU6,PRO-NHET9)-LHRH
(DES-GLY10,SER(AC)4,D-LEU6,PRO-NHET9)-LHRH
(DES-HIS1,GLU9)-GLUCAGON (1-29) AMIDE (HUMAN, RAT, PORCINE)
(DES-MET0)-REC TGF A (HUMAN) (EXPRESSED IN E.COLI)
(DES-OCTANOYL)-GHRELIN (HUMAN)
CAS:313951-59-6
(DES-OCTANOYL)-GHRELIN (MOUSE, RAT)
(DES-PYR1)-LHRH
CAS:38280-53-4
(DES-PYR1,D-SER(TBU)6,AZAGLY10)-LHRH
CAS:96963-20-1
(DES-PYR1,DES-GLY10,D-LEU6,PRO-NHET9)-LHRH
(DES-SER1)-CEREBELLIN
CAS:94245-80-4
(DIACETYL)-A-MSH
(DL-ISOSER1)-TRAP-6
(E)-5-METHYL-1H-PYRROLO[2,3-B]PYRIDINE-3-CARBALDEHYDE OXIME
CAS:1198098-52-0
(FMOC-CYS-OTBU)2
CAS:139592-37-3
(GLN11)-AMYLOID SS-PROTEIN (1-28)
(GLN18)-PLATELET FACTOR 4 (15-22) (HUMAN)
CAS:144207-60-3
(GLN22)-AMYLOID SS-PROTEIN (1-40)
CAS:144410-00-4
(GLN53)-CONNEXIN 37 (51-58) (HUMAN, MOUSE, RAT)
CAS:155893-22-4
(GLU1)-FIBRINOPEPTIDE B
CAS:103213-49-6
(GLU1,D-SER(TBU)6,AZAGLY10)-LHRH
(GLU13·17·20)-OSTEOCALCIN (1-46) (MOUSE)
(GLU2)-TRH
CAS:85541-78-2
(GLU32)-CHARYBDOTOXIN
CAS:321854-18-6
(GLU8·9)-HELODERMIN
CAS:209340-47-6
(GLY0)-MET-ENKEPHALIN
CAS:70013-23-9
(GLY1,SER3·22,GLN4·34,THR6,ARG19,TYR21,ALA23·31,AIB32)-PANCREATIC POLYPEPTIDE (HUMAN)
(GLY21)-AMYLOID SS-PROTEIN (1-40)
CAS:154362-03-5
(GLY22)-AMYLOID SS-PROTEIN (1-40)
CAS:175010-18-1
(H-ARG-GLY-PHE-ALA-PHE-VAL-THR-PHE)8-MAP
(H-ASP-GLU-VAL-ASP)2-RHODAMINE 110
CAS:220846-75-3
(H-CYS-ALA-OH)2
CAS:20898-21-9
(H-CYS-GLY-OH)2
CAS:7729-20-6
(H-CYS-LEU-OH)2
(H-CYS-OME)2.2HCL
CAS:32854-09-4
(H-CYS-PHE-OH)2
CAS:62130-80-7
(H-CYS-TYR-OH)2
CAS:7369-94-0
(H-CYS-VAL-OH)2
CAS:21141-84-4
(H-GLU(CYS-SSNA)-OH)2
CAS:201990-68-3
(H-GLY-CYS-OH)2
CAS:26798-52-7
(H-LYS-ILE-LEU-ASN-ASP-LEU-SER-SER-ASP-ALA-PRO-GLY-VAL-PRO-ARG)8-MAP
(H-TYR-CYS-NH2)2 · 2 TFA
(HIS(1-ME)2)-TRH
(HIS(3-ME)2)-LHRH
CAS:38343-58-7
(HIS32,LEU34)-NEUROPEPTIDE Y (32-36)
CAS:168916-68-5
(HYP3)-BRADYKININ
CAS:37642-65-2
(HYP3,SS-(2-THIENYL)-ALA5,TYR(ME)8-(?)-ARG9)-BRADYKININ
(HYP474·477)-A-FETOPROTEIN (471-478) (HUMAN, LOWLAND GORILLA)
(HYP474·477,GLN479)-CYCLO-A-FETOPROTEIN (471-479) (HUMAN, LOWLAND GORILLA)
(ILE5,TRP23,TYR36)-PTH-RELATED PROTEIN (1-36) (HUMAN, MOUSE, RAT)
CAS:181057-31-8
(ILE5,TRP23,TYR36)-PTH-RELATED PROTEIN (1-36) (HUMAN, RAT)
(ILE76)-TNF-A (70-80) (HUMAN)
(LAUROYL-CYS-TYR-GLY(-GLU-GLU-ASN-VAL)6-OH)2
(LEU13)-MOTILIN (HUMAN, PORCINE)
CAS:59530-69-7
(LEU13-(?)-LEU14)-BOMBESIN
(LEU15)-GASTRIN I (HUMAN)
CAS:39024-57-2
(LEU31,PRO34)-NEUROPEPTIDE Y (13-36) (HUMAN, RAT)
CAS:302798-54-5
(LEU31,PRO34)-NEUROPEPTIDE Y (HUMAN, RAT)
CAS:132699-73-1
(LEU31,PRO34)-NEUROPEPTIDE Y (PORCINE)
CAS:125580-28-1
(LYS(BIOTINYL)29)-CORTISTATIN-29 (HUMAN)
(LYS(BIOTINYL)29)-CORTISTATIN-29 (RAT)
(LYS(ET)33)-THYMOPOIETIN I/II (32-36) (BOVINE)
(LYS(Z)2)-TUFTSIN
(LYS18)-PSEUDIN-2
(LYS22)-AMYLOID SS-PROTEIN (1-40)
CAS:302905-01-7
(LYS3)-BOMBESIN
CAS:66839-66-5
(LYS7)-DERMORPHIN
CAS:142689-18-7
(LYS8)-CONOPRESSIN S
CAS:130836-26-9
(LYS8)-VASOPRESSIN
CAS:50-57-7
(LYS8,LYS9)-NEUROTENSIN (8-13)
CAS:139026-64-5
(LYS9,TRP11,GLU12)-NEUROTENSIN (8-13) (CYCLIC ANALOG)
CAS:160662-16-8
(MET(O)27)-GLUCAGON (1-29) (HUMAN, RAT, PORCINE)
CAS:75217-63-9
(MET(O)4,D-LYS8,PHE9)-ADRENOCORTICOTROPI C HORMONE
CAS:50913-93-4
(MET(O)5)-ENKEPHALIN
CAS:60283-51-4
(MET186)-MELANOCYTE PROTEIN PMEL 17 (185-193) (HUMAN, BOVINE, MOUSE)
(MET5,PRO6,D-PHE7,D-TRP9,PHE10)-A-MSH (5-13)
(N-ME-D-PHE6,D-TRP7·9,LEU10-(?)-LEU11)-SUBSTANCE P (6-11)
(N-ME-D-PHE7)-BRADYKININ
(N-ME-PHE3,D-PRO4)-SS-CASOMORPHIN (1-4) AMIDE (BOVINE)
(N-ME-PHE3,D-PRO4)-SS-CASOMORPHIN (1-4) AMIDE (BOVINE)
CAS:83397-56-2
(N-ME-TYR1,N-ME-ARG7,D-LEU-NHET8)-DYNORPHIN A (1-8)
CAS:103613-84-9
(NLE11)-SUBSTANCE P
CAS:57462-42-7
(NLE13,GLU14)-MOTILIN (HUMAN, PORCINE)
CAS:50881-15-7
(NLE27)-GRF (1-29) AMIDE (HUMAN)
CAS:91869-58-8
(NLE4)-A-MSH
(NLE4,D-PHE7)-A-MSH
CAS:75921-69-6
(NLE6)-SARAFOTOXIN C
CAS:352283-69-3
(NLE8·18,TYR34)-PTH (1-34) (HUMAN)
CAS:78041-34-6
(NLE8·18,TYR34)-PTH (1-34) AMIDE (BOVINE)
CAS:64763-77-5
(NLE8·18,TYR34)-PTH (3-34) AMIDE (BOVINE)
CAS:64297-16-1
(NLE8·18,TYR34)-PTH (7-34) AMIDE (BOVINE)
CAS:71539-01-0
(NLE8·21,TYR34)-PTH (1-34) AMIDE (RAT)
CAS:105267-88-7
(P-AMINO-PHE6)-ANGIOTENSIN II
CAS:90937-05-6
(P-CHLORO-D-PHE6,LEU17)-VIP (HUMAN, BOVINE, PORCINE, RAT)
CAS:102805-45-8
(P-IODO-PHE7)-ACTH (4-10)
(PEN5)-UROTENSIN II (4-11) (HUMAN)
(PHE(4-CL)5·8)-BRADYKININ
CAS:125229-63-2
(PHE1,SER2)-TRAP-6
CAS:374898-11-0
(PHE13,TYR19)-MCH (HUMAN, MOUSE, RAT)
CAS:160201-86-5
(PHE2,ORN8)-OXYTOCIN
CAS:2480-41-3
(PHE22)-BIG ENDOTHELIN-1 FRAGMENT (19-37) (HUMAN)
CAS:189064-07-1
(PHE4)-DERMORPHIN (1-4) AMIDE
CAS:118476-87-2
(PHENYLAC-TYR1,D-ARG2,P-CHLORO-PHE6,ARG9,ABU15,NLE27,D-ARG28,HOMOARG29)-GRF (1-29) AMIDE (HUMAN)
CAS:221377-59-9
(PHENYLAC-TYR1,D-ARG2,P-CHLORO-PHE6,HOMOARG9,TYR(ME)10,ABU15,NLE27,D-ARG28,HOMOARG29)-GRF (1-29) AMIDE (HUMAN)
(PHENYLAC-TYR1,D-ARG2,PHE(4-CL)6,HOMOARG9,TYR(ME)10,ABU15,NLE27,D-ARG28,HOMOARG29)-GRF (1-29) AMIDE (HUMAN)
CAS:221377-79-3
(PHENYLAC1,D-TYR(ET)2,LYS6,ARG8,DES-GLY9)-VASOPRESSIN
CAS:129520-65-6
(PHENYLAC1,D-TYR(ME)2,ARG6·8,LYS-NH29)-VASOPRESSIN
CAS:148565-73-5
(PHENYLAC1,D-TYR(ME)2,ARG6·8,TYR-NH29)-VASOPRESSIN
(PRO18,ASP21)-AMYLOID SS-PROTEIN (17-21)
(PRO3) GASTRIC INHIBITORY PEPTIDE (GIP), HUMAN
(PRO3)-DYNORPHIN A (1-11) AMIDE
CAS:289636-76-6
(PRO30,TYR32,LEU34)-NEUROPEPTIDE Y (28-36)
CAS:161650-01-7
(PRO34)-NEUROPEPTIDE Y (PORCINE)
CAS:128768-54-7
(PROPIONYL1,D-TYR(ET)2,VAL4,ABU6,ARG8·9)-VASOPRESSIN
CAS:121250-95-1
(PS8, PS13) EUCARIOTIC TRANSLATION INITIATION FACTOR 2B, EIF2B??;RRAAEELDPSRAGPSPQL
(PY185)MAP (177-189) KINASE??;DHTGFLTE-PY-VATR
(PYR1)-APELIN-13 (HUMAN, BOVINE, MOUSE, RAT)
CAS:217082-60-5
(PYR1)-OPIORPHIN
CAS:1189350-60-4
(PYR110)-PREPRO-UROTENSIN II (110-123) (RAT)
(PYR16)-VIP (16-28) (CHICKEN)
CAS:73073-47-9
(PYR16)-VIP (16-28) (HUMAN, BOVINE, PORCINE, RAT)
CAS:134907-86-1
(PYR4,CYS(H-CYS-OH)6,ARG8)-VASOPRESSIN (4-8)
(PYR5,N-ME-PHE8,SAR9)-SUBSTANCE P (5-11)
CAS:77128-69-9
(PYR6)-SUBSTANCE P (6-11)
CAS:61123-13-5
(PYR6,PRO9)-SUBSTANCE P (6-11)
CAS:79775-19-2
(R)-?-(2-FLUORO-BENZYL)-L-PROLINE•HCL
CAS:1049733-29-0
(R)-?-(2-METHYL-BENZYL)-L-PROLINE•HCL
CAS:1049734-41-9
(R)-?-(2-TRIFLUOROMETHYL-BENZYL)-L-PROLINE-HCL
CAS:1049743-22-7
(R)-?-(3-BROMO-BENZYL)-L-PROLINE-HCL
CAS:1049734-10-2
(R)-2-((R)-2-AMINOPROPANAMIDO)PROPANOIC ACID; D-ALA-D-ALA-OH;D-ALANYL-D-ALANINE;
CAS:923-16-0
(R)-2-(AMINOMETHYL)-3-METHYLBUTANOIC ACID•HCL
CAS:210345-86-1
(R)-2-METHOXY-PHENYLGLYCINE
CAS:103889-84-5
(R)-3-AMINO-3-(2,3-DIMETHOXY-PHENYL)-PROPIONIC ACID
CAS:742691-70-9
(R)-3-AMINO-3-(2-BROMO-PHENYL)-PROPIONIC ACID
CAS:737751-95-0
(R)-3-AMINO-3-(2-NAPHTHYL)-PROPIONIC ACID
CAS:786637-72-7
(R)-3-AMINO-3-(3-FLUORO-PHENYL)-PROPIONIC ACID
CAS:723284-81-9
(R)-3-AMINO-3-(3-PYRIDYL)-PROPIONIC ACID
CAS:155050-17-2
(R)-3-AMINO-3-(6-METHOXY-3-PYRIDYL)-PROPIONIC ACID
CAS:712321-46-5
(R)-3-AMINO-4-(4-BROMO-PHENYL)-BUTYRIC ACID•HCL
CAS:331763-73-6
(R)-A-BIPHENYL-4-YLMETHYL-PROLINE•HCL
CAS:1049728-81-5
(R)-H-SS-PHE(3-CN)-OH
CAS:761396-82-1
(R)-H-SS-PHE(3-CN)-OH
CAS:761396-82-1
(S)-2-(AMINOMETHYL)-3-METHYLBUTANOIC ACID•HCL
CAS:203854-54-0
(S)-2-2(N-BOC-AMINO)-3-(5-CHLOROINDOL-3-YL)PROPANOIC ACID
CAS:114873-08-4
(S)-2-BENZYL-3-(TERT-BUTOXYCARBONYLAMINO)PROPANOIC ACID
CAS:189619-55-4
(S)-3-AMINO-2-(HYDROXYMETHYL)PROPANOIC ACID
CAS:930784-11-5
(S)-3-AMINO-3-(2,4-DICHLORO-PHENYL)-PROPIONIC ACID
CAS:757937-66-9
(S)-3-AMINO-3-(2-METHOXY-PHENYL)-PROPIONIC ACID
CAS:720662-28-2
(S)-3-AMINO-3-(2-METHYL-PHENYL)-PROPIONIC ACID
CAS:736131-48-9
(S)-3-AMINO-3-(3-CYANO-PHENYL)-PROPIONIC ACID
CAS:791778-00-2
(S)-3-AMINO-3-(3-METHOXY-PHENYL)-PROPIONIC ACID
CAS:783300-35-6
(S)-3-AMINO-3-(3-PYRIDYL)-PROPIONIC ACID
CAS:129043-04-5
(S)-3-AMINO-3-(3-TRIFLUOROMETHYL-PHENYL)-PROPIONIC ACID
CAS:719995-40-1
(S)-3-AMINO-3-(6-METHOXY-3-PYRIDYL)-PROPIONIC ACID
CAS:877119-70-5
(S)-A-BENZYL-PROLINE•HCL
CAS:637020-57-6
(S)-N-FMOC-OCTYLGLYCINE
CAS:193885-59-5
(SAR1)-ANGIOTENSIN I/II (1-7) AMIDE
CAS:126112-22-9
(SAR1)-ANGIOTENSIN II
CAS:51833-69-3
(SAR1,ALA8)-ANGIOTENSIN II
CAS:38027-95-1
(SAR1,GLY8)-ANGIOTENSIN II
CAS:51887-62-8
(SAR1,ILE4·8)-ANGIOTENSIN II
CAS:185461-45-4
(SAR1,ILE8)-ANGIOTENSIN II
CAS:37827-06-8
(SAR1,THR8)-ANGIOTENSIN II
CAS:53632-49-8
(SAR1,TYR(ME)4)-ANGIOTENSIN II
(SAR1,VAL5,ALA8)-ANGIOTENSIN II
CAS:34273-10-4
(SAR24,N-ME-ILE26)-AMYLIN (HUMAN)
(SAR9,MET(O2)11)-SUBSTANCE P
CAS:110880-55-2
(SER(AC)4,D-SER(TBU)6,AZAGLY10)-LHRH
(SER(TBU)6,AZAGLY10)-LHRH
(SER25)-PROTEIN KINASE C (19-31)
CAS:136795-05-6
(SER4,ILE8)-OXYTOCIN
CAS:550-21-0
(SER8)-GLP-1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT)
CAS:215777-46-1
(SS-(2-THIENYL)-ALA5·8,D-PHE7)-BRADYKININ
(SS-ALA70)-C3A (70-77)
CAS:105931-71-3
(SS-ALA70)-C3A (70-77)
CAS:105931-71-3
(SS-ASP3)-GRF (HUMAN)
CAS:142985-02-2
(SS-ASP3)-GRF (HUMAN)
(SS-ASP3)-VIP (HUMAN, BOVINE, PORCINE, RAT)
(SS-ASP5)-DELTA-SLEEP INDUCING PEPTIDE
(SS-ASP5)-DELTA-SLEEP INDUCING PEPTIDE
CAS:82602-88-8
(THR4,GLY7)-OXYTOCIN
CAS:60786-59-6
(THR6)-BRADYKININ
CAS:6120-63-4
(TRP11,D-PHE15·16)-SDF-1 (7-16) (DIMER) (HUMAN, CAT, MOUSE)
(TRP3,ARG5)-GHRELIN (1-5)
CAS:848442-59-1
(TRP6)-LHRH
CAS:156126-74-8
(TRP63,TRP64)-C3A (63-77)
CAS:130154-64-2
(TYR(ME)21)-NEUROPEPTIDE Y (HUMAN, RAT)
CAS:131256-74-1
(TYR0)-C-PEPTIDE (DOG)
CAS:101135-67-5
(TYR0)-C-PEPTIDE (HUMAN)
CAS:57327-90-9
(TYR0)-C-TYPE NATRIURETIC PEPTIDE (32-53) (HUMAN, PORCINE, RAT)
CAS:142878-79-3
(TYR0)-MELANOCYTE-STIMULATING HORMONE-RELEASE INHIBITING FACTOR
CAS:77133-61-0
(TYR0)-UROCORTIN (RAT)
CAS:187111-93-9
(TYR0,TRP2)-MELANOCYTE-STIMULATING HORMONE-RELEASE INHIBITING FACTOR
CAS:144450-13-5
(TYR1)-TRAP-7
CAS:149440-16-4
(TYR11)-SOMATOSTATIN-14
CAS:59481-27-5
(TYR15)-FIBRINOPEPTIDE B
CAS:125455-56-3
(TYR27)-A-CGRP (27-37) (CANINE, MOUSE, RAT)
(TYR27)-PTH (27-48) (HUMAN)
CAS:90686-51-4
(TYR34)-PTH (7-34) AMIDE (BOVINE)
CAS:86292-93-5
(TYR36)-PTH-RELATED PROTEIN (1-36) AMIDE (CHICKEN)
CAS:152617-91-9
(TYR38,PHE42·46)-OSTEOCALCIN (38-49) (HUMAN)
CAS:129356-77-0
(TYR4)-BOMBESIN
CAS:67338-70-9
(TYR4,D-PHE12)-BOMBESIN
CAS:108437-89-4
(TYR43)-PTH (43-68) (HUMAN)
CAS:92952-95-9
(TYR52,ASP76)-PTH (52-84) (HUMAN)
CAS:84069-01-2
(TYR6,D-PHE7,D-HIS9)-SUBSTANCE P (6-11)
CAS:145194-26-9
(TYR8)-BRADYKININ
CAS:32222-00-7
(TYR9)-CHOLECYSTOKININ OCTAPEPTIDE (SULFATED)
(TYR9)-SS-MSH (PORCINE)
(TYR9)-SS-MSH (PORCINE)
CAS:198281-81-1
(VAL3)-SS-CASOMORPHIN (1-4) AMIDE (BOVINE)
CAS:104180-22-5
(VAL3)-SS-CASOMORPHIN (1-4) AMIDE (BOVINE)
(VAL438)-TYROSINASE (432-444) (HUMAN)
CAS:320341-56-8
(VAL5)-ANGIOTENSIN II
CAS:5649-07-0
(VAL671)-AMYLOID SS/A4 PROTEIN PRECURSOR770 (667-676)
(Z-AA)2RH110;(Z-AA)2RH110
(Z-ALA-ALA-ALA-ALA)2RH110;(Z-AAAA)2RH110
(Z-AR)2RH110?2HCL;(Z-AR)2RH110?HCL
(Z-ARG)2RH110 ? 2HCL;(Z-R)2RH110?2HCL
(Z-ASP-GLU-VAL-ASP)2-RHODAMINE 110
CAS:223538-61-2
(Z-CYS-OH)2
CAS:11/2/68
(Z-PHE-ARG)2RH110;(Z-FR)2RH110
? I PROBE;SREWEDGFGGRWLSR
? II PROBE;SSLDLSQFPMTASFLRESR
? III PROBE;SSEACVGRWMLCEQLGVSR
?- BAG CELL PEPTIDE
?-2-MSH (41-58), AMIDE;YVMGHFRWDRFG-NH2
?-2-MSH (41-58);YVMGHFRWDRFG
CAS:72711-43-4
?-AMYLOID (1-40)
?-AMYLOID PEPTIDE (1-42), RAT
?-AMYLOID PRECURSOR PROTEIN: 732-751
?-BAG CELL PEPTIDE;RLRFD
?-BAG CELL PEPTIDE;RLRFH
?-CONOTOXIN GVIA
CAS:106375-28-4
?-CONOTOXIN GVIA;CKS(HYP)GSSCS(HYP)TSYNCCRSCN(HYP)YTKRCY-NH2
CAS:106375-28-4
?-CONOTOXIN MVIIA
CAS:107452-89-1
?-CONOTOXIN MVIIA;CKGKGAKCSRLMYDCCTGSCRSGKC-NH2(DISULFIDEBRIDGE:1-16,8-20,AND15-25)
CAS:107452-89-1
?-CONOTOXIN MVIIC
CAS:147794-23-8
?-ENDORPHIN
CAS:60893-02-9
?-MSH (3-8)
?-NEUROPEPTIDE, RABBIT
?-NEUROPROTECTIN;ADLIAYL-NH2
?-TAC4 (30-61)-NH2??;TEAETWEGAGPSIQLQLQEVKTGKASQFFGLM-NH2
?-TAC4 (32 - 50)
?1-MSH
CAS:72629-65-3
?2-MSH
CAS:72711-43-4
?3-MSH
CAS:72629-64-2
?3-MSH:GAMMA3-MSH
CAS:72629-64-2
?AMYLOID BRI PEPTIDE (1-34)
[(2R,4R,5S)-2-BENZYL-5-(BOC-AMINO)-4-HYDROXY-6-PHENYL-HEXANOYL]-LEU-PHE-NH2
[?-ALA8]-NEUROKININ A (4-10);DSFV-(?-A)-LM-NH2
[1,2,4]TRIAZOLO[1,5-A]PYRIDIN-6-YLBORONIC ACID PINACOL ESTER
CAS:1160790-18-0
[2-ME-ALA2] B-ENDORPHIN, HUMAN
[3,4-DEHYDRO-PRO]3-THYROTROPIN RELEASING HORMONE, [?PRO3]-TRH
[3-ME-HIS2] TRH
[4-BENZOYL-PHE]8-SUBSTANCE P;RPKPQQF-F(4-BZ)-GLM-NH2
[4-CHLORO-PHE]7,8-SUBSTANCE P;RPKPQQ-F(4-CL-F)-GLM-NH2
CAS:73646-81-8
[4CLDPHE6,LEU17] VIP
CAS:102805-45-8
[AC-CYS4, D-PHE7, CYS10]-A-MSH (4-13), AMIDE;AC-CEHFRWCKPV-NH2
CAS:91050-39-4
[ALA 353, 367]PRESENILIN 1 (349-361)
[ALA1,3,11,16]-ENDOTHELIN 1, HUMAN;ASASSLMDKEAVYFAHLDIIW
CAS:121204-87-3
[ALA1]-PAR-4 (1-6) (MOUSE)
CAS:380900-00-5
[ALA11,22,28]-VIP (HUMAN, BOVINE, PORCINE, RAT)
CAS:291524-04-4
[ALA11,D-LEU15]-OREXIN B (HUMAN)
CAS:532932-99-3
[ALA127] HEPATITIS B VIRUS PRE-S REGION (120-131)
[ALA13]-APELIN-13;H-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-ALA-OH
CAS:568565-11-7
[ALA144] - PLP (139 - 151) A144 - PLP(139 - 151)
[ALA144]-PLP (139-151) A144-PLP(139-151);HSLGKALGHPDKF
[ALA18] ENDOTHELIN-1, HUMAN
[ALA2] ENDOTHELIN-3, HUMAN
[ALA2] MET-ENKEPHALIN, AMIDE
[ALA26, LEU27]-MELAN-A (26-35);ALAGIGILTV
[ALA26]-MELAN-A/MART-1 (26-35);AAAGIGILTV
[ALA286]-CALMODULIN-DEPENDENT PROTEIN KINASE II (281-302) ((ALA286)-CAMK-II (281-302))
CAS:141055-85-8
[ALA3,11,18, NLE7] ENDOTHELIN-1, HUMAN
[ALA31,AIB32]-NEUROPEPTIDE Y (PORCINE)
CAS:313988-59-9
[ALA4]-MBP (1-11);AC-ASQARPSQRHG
[ALA5, ?-ALA8]-NEUROKININ A (4-10);DAFV-(?-A)-LM-NH2
CAS:127633-71-0
[ALA6,D-TRP8]-GALANIN (1-15)-OL;GWTLNAAWYLLGPHA-OL
[ALA8]-HUMANIN, [ALA8]-HN, SHNA;MAPRGFSALLLLTSEIDLPVKRRA
[ALA81]-MBP (74-85);QKSQRSQAENPV
[ALA9] AUTOCAMTIDE 2: AUTOCAMTIDE-2-RELATED INHIBITORY PEPTIDE
CAS:167114-91-2
[APLILSR]PPSA
[ARG0] MET-ENKEPHALIN
[ARG13] B-AMYLOID (1-40)
[ARG14,20,21, LEU16]-PACAP (1-27)-GLY-LYS-ARG, AMIDE, HUMAN, OVINE, RAT;HSDGIFTDSYSRYRRQLAVRRYLAAVLGKR-NH2
[ARG15,20,21, LEU17] VIP-GLY-LYS-ARG-NH2
[ARG15,ASP16,25,PRO18,21,23,VAL22,ILE24]-AMYLOID SS-PROTEIN (15-25)
[ARG22] B-AMYLOID: 1-40?
[ARG3,14]CTX IV (3-14)
[ARG3] SUBSTANCE P
[ARG3]-AMYLOID SS-PROTEIN (1-40)
[ARG8] DEAMINO VASOPRESSIN DESGLYCINAMIDE
[ARG8] GTP-BINDING PROTEIN FRAGMENT, GS ALPHA
[ARG8] VASOPRESSIN DESGLYCINAMIDE
CAS:37552-33-3
[ARG8]-A-NEO-ENDORPHIN (1-8)
CAS:75106-72-8
[ARG8]-CONOPRESSIN G
CAS:130836-24-7
[ARG8]-VASOPRESSIN (4-9)
CAS:96027-30-4
[ARG8]-VASOPRESSIN (AVP);CYFQNCPRG-NH2(DISULFIDEBRIDGE:1-6)
CAS:113-79-1
[ARG8]-VASOPRESSIN, FREE ACID;CYFQNCPRG(DISULFIDEBRIDGE:1-6)
[ARG91, ALA96]-MBP (87-99), HUMAN;VHFFRNIVTARTP
[ASN1, VAL5, ASN9] ANGIOTENSIN I, SALMON
CAS:86879-15-4
[ASN1,VAL5]-ANGIOTENSIN II
CAS:53-73-6
[ASN10,LEU11,D-TRP12]-PTH-RELATED PROTEIN (7-34) AMIDE (HUMAN, RAT)
[ASN18] ENDOTHELIN-1, HUMAN
[ASN670,LEU671]-AMYLOID SS/A4 PROTEIN PRECURSOR770 (667-675)
CAS:150234-52-9
[ASN670,LEU671]-AMYLOID SS/A4 PROTEIN PRECURSOR770 (667-676)
CAS:186142-28-9
[ASN8, LEU18] PARATHYROID HORMONE (1-34), HUMAN
[ASP22] B-AMYLOID (1-40)
[ASP370]-TYROSINASE (368-376)??;YMDGTMSQV
CAS:168650-46-2
[ASP5,6,ME-PHE8] SUBSTANCE P
[ASU 1,6] OXYTOCIN
CAS:14317-68-1
[CIT5]-TRAP-5
CAS:287184-84-3
[CYS(ACM)2,7]-A-CGRP (HUMAN)
[CYS: ACM20,31] EPIDERMAL GROWTH FACTOR: 20-31
CAS:89991-90-2
[CYS: BZL84] CD: 81-92
[CYS2, TYR3, ORN5, PEN7]-SOMATOSTATIN 14 (7-14), AMIDE;FCYW(ORN)T(PEN)T-NH2(DISULFIDEBRIDGE:2-7)
CAS:103429-31-8
[CYS21] CORTICOTROPIN RELEASING FACTOR, HUMAN, RAT
[CYS3,6, TYR8, PRO10]-SUBSTANCE P;RPCPQCFYGPM-NH2(DISULFIDEBRIDGE:3-6)
[CYS3,6, TYR8, PRO9]-SUBSTANCE P;RPCPQCFYPLM-NH2(DISULFIDEBRIDGE:3-6)
CAS:141459-28-1
[CYS8,13]-DYNORPHIN A (1-13) AMIDE
[CYS8] RENIN SUBSTRATE TETRADECAPEPTIDE, RAT
[CYSCYS21] ATRIAL NATRIURETIC FACTOR (3-28), RAT
[D-ALA1] PEPTIDE T, AMIDE
CAS:106362-34-9
[D-ALA2, D-LEU5]-ENKEPHALIN;YAGFL
CAS:63631-40-3
[D-ALA2,4,TYR5] -B-CASOMORPHIN (1-5), AMIDE, BOVINE
CAS:98815-38-4
[D-ALA2,D-PRO4,TYR5] -B-CASOMORPHIN (1-5), AMIDE
CAS:83936-24-7
[D-ALA2,DMET5] ENKEPHALIN
CAS:100929-50-8
[D-ALA2,HYP4,TYR5]- B-CASOMORPHIN (1-5) AMIDE
CAS:102029-98-1
[D-ALA2,LEU5,ARG6] ENKEPHALIN
[D-ALA2,MET5]- SS-CASOMORPHIN (1-5) , BOVINE ,AMIDE
[D-ALA2,MET5]- SS-CASOMORPHIN (1-5), BOVINE
[D-ALA2] DELTORPHIN I
CAS:122752-15-2
[D-ALA2] DELTORPHIN II
CAS:122752-16-3
[D-ALA2] DYNORPHIN A (1-9), PORCINE
[D-ALA2] LEU-ENKEPHALIN, AMIDE
[D-ALA2] MET-ENKEPHALIN
CAS:61370-87-4
[D-ALA2]- SS-CASOMORPHIN (1-4) AMIDE (BOVINE)
[D-ALA2]- SS-CASOMORPHIN (1-5) AMIDE (BOVINE)
[D-ALA2]- SS-CASOMORPHIN (1-5), BOVINE
[D-ALA2]-B-CASOMORPHIN (1-6), BOVINE
[D-ALA2]-GROWTH HORMONE RELEASING FACTOR, GRF (1-29), AMIDE, HUMAN;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
CAS:86168-78-7
[D-ALA2]-SS-CASOMORPHIN (1-3) AMIDE
[D-ALA4]-SUBSTANCE P (4-11)
CAS:81381-50-2
[D-ARG0,HYP2,3,D-PHE7]-BRADYKININ
CAS:111929-26-1
[D-ARG0,HYP3,D-PHE7,LEU8]-BRADYKININ
CAS:135701-67-6
[D-ARG0,HYP3,D-PHE7]-BRADYKININ
CAS:109333-26-8
[D-ARG1,D-PRO2,D-PHE7,D-HIS9]-SUBSTANCE P
CAS:115760-58-2
[D-ARG1,D-PRO2,D-TRP7,9,LEU11]-SUBSTANCE P
CAS:84676-91-5
[D-ARG1,D-TRP5,7,9,LEU11]-SUBSTANCE P
[D-ARG2,LYS4]-DERMORPHIN (1-4), AMIDE
[D-ARG2,SAR4]-DERMORPHIN (1-4)
CAS:90549-86-3
[D-ARG2] DERMORPHIN (1-4), AMIDE
[D-ARG2]- KYOTORPHIN
[D-ARG25]-NEUROPEPTIDE Y, HUMAN, RAT: [D-ARG25]-NPY, HUMAN, RAT
[D-ARG25]-NEUROPEPTIDE Y, HUMAN, RAT;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
[D-ARG6,ASN10]-MCH (6-16) AMIDE (HUMAN, MOUSE, RAT)
[D-ARG6] - DYNORPHIN A (1 - 13), PORCINE
CAS:75921-87-8
[D-ARG8]-DYNORPHIN A (1-13), PORCINE;YGGFLRRRRPKLK
CAS:125357-12-2
[D-ASP1]-AMYLOID- B-PROTEIN (1-42)
[D-CYS6,ASN7,D-ALA11,CYS14]-BOMBESIN (6-14)
[D-GLU5,D-TRP7,9,10]-SUBSTANCE P (5-11)
CAS:289632-61-7
[D-HIS26]-NEUROPEPTIDE Y, HUMAN, RAT: [D-HIS26]-NPY, HUMAN, RAT
[D-HIS26]-NEUROPEPTIDE Y, HUMAN, RAT;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
[D-LEU2]-MELANOCYTE-STIMULATING HORMONE-RELEASE INHIBITING FACTOR
CAS:39705-60-7
[D-LYS16]-ACTH(1-24)
[D-LYS3]-GHRP-6;HWKWFK-NH2
CAS:136054-22-3
[D-MET2,PRO5] ENKEPHALIN, AMIDE
[D-PEN2, 5]-ENKEPHALIN;Y-(D-PEN)-G-F-(D-PEN)
CAS:88373-73-3
[D-PHE11]-NEUROTENSIN;PYR-LYENKPRRPFIL
[D-PHE12, LEU14]-BOMBESIN;PYR-QRLGNQWAVGFLL-NH2
CAS:108437-88-3
[D-PHE12]-BOMBESIN;PYR-QRLGNQWAVGFLM-NH2
CAS:108437-87-2
[D-PHE2]-VIP (HUMAN, BOVINE, PORCINE, RAT)
CAS:104051-15-2
[D-PHE6,LEU-NHET13,DES-MET14]-BOMBESIN (6-14)
CAS:124199-90-2
[D-PHE7, D-TRP10]-SOMATOSTATIN 14 (7-14);FCYWKTCT(DISULFIDEBRIDGE:8-13)
[D-PHE7] A-MSH, AMIDE
[D-PHE7]-ACTH, A-MSH (1-13), AMIDE;SYSMEHFRWGKPV-NH2
CAS:53697-27-1
[D-PHE7]-BRADYKININ;RPPGFSFFR
[D-PHE7]-SOMATOSTATIN-14
[D-PRO10]-DYNORPHIN A (1-11), PORCINE
[D-PRO194]-IL-1 B (193-195) (HUMAN)
CAS:117027-34-6
[D-PRO2, D-TRP6,8, NLE10]-NEUROKININ B;DPHDFWVWL-NLE-NH2
CAS:109212-72-8
[D-PRO2,D-PHE7,D-TRP9]-SUBSTANCE P
CAS:77275-70-8
[D-PRO2]-B-CASOMORPHIN (1-5) , BOVINE, AMIDE
[D-PRO2]-B-CASOMORPHIN (1-5) ,BOVINE
[D-PRO4,D-TRP7,9,10,VAL8]-SUBSTANCE P (4-11)
[D-PRO4,D-TRP7,9,10]-SUBSTANCE P (4-11)
CAS:86917-57-9
[D-PRO4,D-TRP7,9,NLE11]-SUBSTANCE P (4-11)
CAS:89430-34-2
[D-SER1]-ACTH (1-24), HUMAN
[D-SER13]-SOMATOSTATIN-14
[D-SER14] - HUMANIN (HN)
[D-SER2] LEU-ENKEPHALIN-THR
CAS:75644-90-5
[D-TRP11]-NEUROTENSIN;PYR-LYENKPRRPWIL
[D-TRP12,TYR34]-PTH (7-34) AMIDE (BOVINE)
CAS:118102-98-0
[D-TRP2,7,9]-SUBSTANCE P
CAS:100930-11-8
[D-TRP2] MET-ENKEPHALIN, AMIDE
[D-TRP32]-NEUROPEPTIDE Y (HUMAN)
[D-TRP32]-NEUROPEPTIDE Y (PORCINE)
CAS:153549-78-1
[D-TRP32]-NEUROPEPTIDE Y, HUMAN, RAT;YPSKPDNPGEDAPAEDMARYYSALRHYINLIWRQRY-NH2
CAS:178861-83-1
[D-TRP34]-NEUROPEPTIDE Y, HUMAN: [D-TRP34]-NPY, HUMAN
[D-TRP34]-NEUROPEPTIDE Y, HUMAN;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRWRY-NH2
[D-TRP6,8,9]-GALANIN (1-15)-OL;GWTLNWAWWLLGPHA-OL
[D-TRP8,D-CYS14]-SOMATOSTATIN-14
CAS:61950-59-2
[D-TRP8]-SOMATOSTATIN-14
CAS:58976-46-8
[D-TYR11]-NEUROTENSIN
[D-TYR11]-NEUROTENSIN;PYR-LYENKPRRPYIL
CAS:39379-15-2
[D-TYR27,36, D-THR32]-NEUROPEPTIDE Y (27-36), RAT;YINLITRQRY-NH2
CAS:163887-48-7
[D-TYR27,36, D-THR32]-NEUROPEPTIDE Y, HUMAN;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
[D-TYR6, ?-ALA11, ?-PHE13, NLE14]-BOMBESIN (1-14);PYR-QRLGYQWAV-(?-A)-H-(?-F)-NLE-NH2
[D-TYR6, ?-ALA11, PHE13, NLE14]-BOMBESIN (6-14);YQWAV-(?-A)-HF-NLE-NH2
[D-TYR6, B-ALA11, SS-PHE13, NLE14]-BOMBESIN
[D-VAL22] BIG ENDOTHELIN-1 (16-38), HUMAN
CAS:158884-64-1
[DALA2,: PCLPHE3] B-CASOMORPHIN, AMIDE, BOVINE
[DALA2,TYR5] B-CASOMORPHIN: 1-5, AMIDE, BOVINE
[DALA2] A-NEO-ENDORPHIN: 1-2, AMIDE
[DALA2] B-LIPOTROPIN (61-69)
[DALA2] DYNORPHIN A (1-13), AMIDE, PORCINE
[DALA2] G-ENDORPHIN
[DALA2], LEU-ENKEPHALIN
CAS:64963-01-5
[DALA6,DES-GLY10] LH-RH, ETHYL AMIDE
CAS:79561-22-1
[DALA6] LH-RH
CAS:51230-19-4
[DEAMINO-CYS1, D-ARG8]-VASOPRESSIN, FREE ACID;3-MERCAPTOPROPIONYL-YFQNCPRG(DISULFIDEBRIDGE:1-6)
[DEAMINO-CYS1,D-3-PYRIDYLALA2,ARG8] VASOPRESSIN
CAS:136105-89-0
[DEAMINO-PEN1,VAL4,DARG8] VASOPRESSIN
CAS:64158-84-5
[DEAMINO1, ARG8] VASOPRESSIN
[DEHYDRO-PRO4] SUBSTANCE P (4-11)
[DEHYDROPRO2,4, PRO9]-SUBSTANCE P
[DES ASP10]DECORSIN
[DES-AC, BIOTIN] ICE INHIBITOR III
[DES-AC] A-MSH, AMIDE
[DES-AC]-A-MSH, AMIDE;SYSMEHFRWGKPV-NH2
[DES-ALA1,DES-GLY2,HIS4,5,D-TRP8]-SOMATOSTATIN-14
[DES-ARG1]-BRADYKININ;PPGFSPFR
CAS:16875-11-9
[DES-ARG10]-HOE I40;RRP-HYP-G-THI-S-(D-TIC)-OIC
[DES-ARG30,DES-PRO31]-DENDROASPIS NATRIURETIC PEPTIDE
[DES-ASP10]DECORSIN, LEECH
[DES-GLN16]-PACAP (6-27), AMIDE, HUMAN, OVINE, RAT;FTDSYSRYRKMAVKKYLAAVL-NH2
[DES-GLY10,DLEU6, PRONHET9] LH-RH, ACETATELEUPROLIDE, ACETATE
CAS:74381-53-6
[DES-GLY10] LH-RH, ETHYL AMIDE
CAS:38234-21-8
[DES-HIS1, GLU9]-GLUCAGON (1-29), AMIDE;SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2
CAS:110084-95-2
[DES-HIS1,GLU9] GLUCAGON
[DES-LEU26,CYS(ACM)20,31]-EGF (20-31)
[DES-LEU9]-KINETENSIN
[DES-OCTANOYL]-GHRELIN, HUMAN;GSSFLSPEHQRVQQRKESKKPPAKLQPR
CAS:313951-59-6
[DES-OCTANOYL]-GHRELIN, RAT;GSSFLSPEHQKAQQRKESKKPPAKLQPR
CAS:307950-60-3
[DES-PRO2] BRADYKININ
CAS:80943-05-1
[DES-SER1] CEREBELLIN
CAS:94245-80-4
[DES-THR5]-GLUCAGON
[DES-THR7]-GLUCAGON
[DES-TYR1,DPEN2,5] ENKEPHALIN
[DES-TYR1,DPEN2,PEN5] ENKEPHALIN
[DES-TYR1] B-CASOMORPHIN, BOVINE
[DES-TYR1] DYNORPHIN A: 1-8
[DES-TYR1] G-ENDORPHIN
CAS:67810-56-4
[DES-TYR1] LEU-ENKEPHALIN
CAS:60254-83-3
[DES-TYR1] MET-ENKEPHALIN
CAS:61370-88-5
[DES-TYR1]-SS-ENDORPHIN, HUMAN
[DGLP1,DPHE2,DTRP3,6]-LH-RH
CAS:68059-94-9
[DLEU6, VAL7]-LH-RH (1-9) ETHYL AMIDE
[DLYS6] LH-RH
CAS:130751-49-4
[DPHE2,5,: PCLPHE4] ENKEPHALIN
[DPHE2,6, PRO3]-LH-RH
CAS:67019-15-2
[DPHE2,DALA6] LH-RH
CAS:54784-44-0
[DPRO2,DTRP7,9] SUBSTANCE P
CAS:80434-86-2
[DPRO2] B-CASOMORPHIN: 1-4, AMIDE
[DPRO4,DTRP7,9] SUBSTANCE P: 4-11
CAS:81039-85-2
[DPRO4] B-CASOMORPHIN (1-4), AMIDE, BOVINE
[DPRO5] CORTICOTROPIN RELEASING FACTOR, HUMAN, RAT
[DSER(TBU)6, DES-GLY10]-LH-RH, ETHYL AMIDE
[DTHR2] LEU-ENKEPHALIN-THR
[DTRP6]-LH-RH TRIPTORELINE, ETHYL AMIDE
[DTRP8,TYR11] SOMATOSTATIN
[DVAL22, PHE33] BIG ENDOTHELIN-1: 16-38, HUMAN
[FMOC-GLU70,ALA71,72,LYS74]-C3A (70-77)
[GLA17,21,24]-OSTEOCALCIN (1-49);YLYQWLGAPVPYPDPL-GLA-PRR-GLA-VC-GLA-LNPDCDELADHIGFQEAYRRFYGPV(GLA=?-CARBOXYGLUTAMICACID:DISULFIDEBRIDGE:23-29)
CAS:136461-80-8
[GLN11] -SS- AMYLOID (1 - 28)
[GLN11] -SS- AMYLOID (1 - 40)
[GLN11] B-AMYLOID: 1-40?
[GLN11]-BETA-AMYLOID (1-16);DAEFRHDSGYQVHHQK
CAS:133605-53-5
[GLN11]-BETA-AMYLOID (1-40);DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
CAS:106686-61-7
[GLN144] - PLP (139 - 151), Q144 - PLP(139 - 151)
[GLN144]-PLP (139-151), Q144-PLP(139-151);HSLGKQLGHPDKF
[GLN18]-PLATELET FACTOR 4 (15-22) (HUMAN)
CAS:144207-60-3
[GLN22] ?AMYLOID (1-40)
[GLN22]-25359-AMYLOID (6-40);HDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
[GLN22]-BETA-AMYLOID (1-40);DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
[GLN22]-BETA-AMYLOID (6-40);HDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
[GLN4]-NEUROTENSIN;PYR-LYQNKPRRPYIL
[GLN8, GLN9] HELODERMIN
[GLN9]-AMYLOID SS-PROTEIN (1-40)
[GLP5,(ME)PHE8,SAR9] SUBSTANCE P (5-11)
CAS:77128-69-9
[GLP5,SAR9] SUBSTANCE P (5-11)
[GLU1] FIBRINOPEPTIDE B, HUMAN
CAS:103213-49-6
[GLU1] TRH
[GLU10]-ACTH (1-17);SYSMEHFRWEKPVGKKR
[GLU2]-TRH
CAS:85541-78-2
[GLU27] PROTEIN KINASE C (19-36)
[GLU3,4,7,10,14]-CONANTOKIN G
[GLU32]-CHARYBDOTOXIN;PYR-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKECRCYS(DISULFIDEBRIDGE:7-28,13-33AND17-35)
CAS:321854-18-6
[GLY1,SER3,22,GLN4,34,THR6,ALA19,TYR21,ALA23,31, AIB32]-PANCREATIC POLYPEPTIDE (HUMAN)
[GLY102]-MCC (88-103), MCCPT102G;ANERADLIAYLKQAGK
CAS:213260-63-0
[GLY11] SUBSTANCE P
[GLY22]-?-AMYLOID (1-40)
[GLY22]-AMYLOID SS-PROTEIN (1-42)
[GLY22]-BETA-AMYLOID (1-40);DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV
[GLY28,CYS30]-AMYLOID SS-PROTEIN (1-30)
[GLY30, CYS31] SS-AMYLOID (13-31)??NEW;HHQKLVFFAEDVGSNKGGC
[GLY30,CYS31]- B-AMYLOID (13-31)
[HIS1, LYS6]-GHRP, GHRP-6;HWAWFK-NH2
CAS:87616-84-0
[HIS1,NLE27] GHRF (1-32), AMIDE, HUMAN
[HIS11]SUBSTANCE P
[HIS7] CORAZONIN
[ILE-SER]-BRADYKININ (T-KININ);ISRPPGFSPFR
CAS:86030-63-9
[ILE12, VAL15] MUC5AC ANALOG 3
[ILE161]MAGE - A2 (157-166)
[ILE3] PRESSINOIC ACID
CAS:34330-23-9
[ILE34] BETA-AMYLOID (25-34);GSNKGAIIGI
[ILE34]-SS- AMYLOID (25 - 34)
[ILE76]-TNF-A (70-80) (HUMAN)
[ILE8]-OXYTOCIN
[LEU116]-PREPRO-NEUROMEDIN U (104-136) (HUMAN)
[LEU13] MOTILIN, HUMAN, PORCINE
CAS:59530-69-7
[LEU144, ARG147]-PLP (139-151), [L144, R147-PLP(139-151)];HSLGKLLGRPDKF
CAS:188859-65-6
[LEU144] - PLP (139 - 151), L144 - PLP(139 - 151)
[LEU144]-PLP (139-151), L144-PLP(139-151);HSLGKLLGHPDKF
[LEU15]-GASTRIN I (HUMAN)
CAS:39024-57-2
[LEU17, D-TRP32]-NEUROPEPTIDE Y, HUMAN;YPSKPDNPGEDAPAEDLARYYSALRHYINLIWRQRY-NH2
[LEU18] PARATHYROID HORMONE (1-34), HUMAN
[LEU27]-MELAN-A, MART 1 (26-35);ELAGIGILTV
[LEU28]-MELAN-A (27-35);ALGIGILTV
[LEU31, PRO34]-NEUROPEPTIDE Y, HUMAN, RAT;YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2
CAS:132699-73-1
[LEU31, PRO34]-NEUROPEPTIDE Y, PORCINE;YPSKPDNPGEDAPAEDARYYSALRHYINLLTRPRY-NH2
CAS:125580-28-1
[LEU31, PRO34]-PEPTIDE YY, HUMAN;YPIKPEAPGEDASPEELNRYYASLRHYLNLLTRPRY-NH2
[LEU31, PRO34]PEPTIDE YY, PYY, HUMAN
[LEU31,PRO34]-NEUROPEPTIDE Y (13-36) (HUMAN, RAT)
CAS:302798-54-5
[LEU5]-ENKEPHALIN;YGGFL
CAS:58822-25-6
[LEU8, DES-ARG9]-BRADYKININ;RPPGFSPL
CAS:64695-06-3
[LEU8,D-TRP22,TYR25]-SOMATOSTATIN-28
[LEU8] RENIN SUBSTRATE TETRADECAPEPTIDE, RAT
[LYS0] - ? - 1 - MSH (41 - 58), AMIDE
[LYS0] G-1-MSH, AMIDE
[LYS0]-?-1-MSH (41-58), AMIDE;KYVMGHFRWDRFG-NH2
[LYS0]-BRADYKININ (KALLIDIN);KRPPGFSPFR
CAS:342-10-9
[LYS1, PRO2,5,ARG3,4,TYR6] VIP, HUMAN, PORCINE, RAT, OVINE
[LYS1015,1024]-THROMBOSPONDIN-1 (1015-1024) (HUMAN, BOVINE, MOUSE)
[LYS15]-AMYLOID SS-PROTEIN (15-21)
[LYS22] B-AMYLOID: 1-40
[LYS3, PHE10, TYR13]-AUTOCAMTIDE-2-RELATED INHIBITORY PEPTIDE (AIP) ANALOG;KKKLRRQEAFDAY
[LYS3]-BOMBESIN;PYR-QKLGNQWAVGHLM-NH2
CAS:66839-66-5
[LYS4] SARAFOTOXIN S6C
CAS:116495-45-5
[LYS4]-SARAFOTOXIN 6C;CTCKDMTDEECLNFCHQDVIW(DISULFIDEBRIDGE:1-15AND3-11)
[LYS5, MELEU9, NIE10]-NEUROKININ A (4-10)
[LYS5, NMELEU9, NIE10]-NEUROKININ A (4-10);DKFVG-(NMEL)-NIE-NH2
[LYS8,9]-NEUROTENSIN (8-13);KKPYIL
CAS:139026-64-5
[LYS8,ASN9] NEUROTENSIN LANT-6 (8-13)
[LYS8] DEAMINO VASOPRESSIN DESGLYCINAMIDE
[LYS8] LH-RH
[LYS8] VASOPRESSIN
CAS:50-57-7
[LYS8] VASOPRESSIN DESGLYCINAMIDE
[LYS8]-CONOPRESSIN S
[LYS8]-VASOTOCIN (FREE ACID)
[MEPHE8,SAR9] SUBSTANCE P
[MET: O21] CORTICOTROPIN RELEASING FACTOR, OVINE
[MET: O24, DLYS8, PHE9] ACTH: 4-9, HUMAN
[MET2]-DELTORPHIN
[MET5,ARG6,7,VAL8,GLY9] ENKEPHALIN
[MET5]-ENKEPHALIN-ARG-GLY-LEU
[MET5]-ENKEPHALIN-ARG-PHE
CAS:100929-69-9
[MET5]-ENKEPHALIN;YGGFM
CAS:58569-55-4
[MPR1,VAL4,DARG8] VASOPRESSIN
CAS:43157-23-9
[MPR7, DALA9] ANP (7-28), AMIDE, RAT
[NLE10]-NEUROKININ A (4-10)
[NLE11] SUBSTANCE P
CAS:57462-42-7
[NLE13]-MOTILLIN
[NLE21,TYR32] CORTICOTROPIN RELEASING FACTOR, OVINE
[NLE253]-HSV-1 UL 26 OPEN READING FRAME (238-257)
[NLE27]-GRF (1-29) AMIDE (HUMAN)
CAS:91869-58-8
[NLE35] B-AMYLOID: 1-40?
[NLE35] BETA-AMYLOID (17-42);LVFFAEDVGSNKGAIIGL-NLE-VGGVVIA
[NLE35]-BETA-AMYLOID (1-40);DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-NLE-VGGVV
[NLE35]-BETA-AMYLOID (1-42);DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-NLE-VGGVVIA
[NLE35]-BETA-AMYLOID (25-35);GSNKGAIIGL-NLE
CAS:163265-32-5
[NLE4] A-MSH, AMIDE
[NLE4]-A-MSH, AMIDE;AC-SYS-NLE-EHFRWGKPV-NH2
CAS:75921-69-6
[NLE8,18, TYR34] PARATHYROID HORMONE (1-34), HUMAN
CAS:78041-34-6
[NLE8,18,TYR34] PARATHYROID HORMONE (7-34), AMIDE, BOVINE
[NLE8] PANCREASTATIN, PORCINE
[NLE8] SOMATOSTATIN (1-28)
[NLE8’18,TYR34]-PTH (1-34) AMIDE (BOVINE)
CAS:64763-77-5
[NLE8’18,TYR34]-PTH (3-34) AMIDE (BOVINE)
CAS:64297-16-1
[NLE8’18,TYR34]-PTH (7-34) AMIDE (BOVINE)
CAS:71539-01-0
[NLE8’21,TYR34]-PTH (1-34) AMIDE (RAT)
CAS:105267-88-7
[NMEPHE3, DPRO4] B-CASOMORPHIN: 1-4, AMIDE, BOVINE
CAS:83397-56-2
[NMETYR1] DYNORPHIN A: 1-13, AMIDE, PORCINE
[PCLPHE5,8] BRADYKININ
CAS:125229-63-2
[PGLU16]-VIP (16-28), PORCINE;PYR-MAVKKYLNSILN-NH2
CAS:134907-86-1
[PHE1,SER2,TYR6]-PAR-1 (1-6) AMIDE (HUMAN)
CAS:245329-02-6
[PHE1,SER2]-TRAP-6
CAS:374898-11-0
[PHE10] B-AMYLOID: 1-40?
[PHE13,TYR19]-MCH (HUMAN, MOUSE, RAT)
CAS:160201-86-5
[PHE1376]-FIBRONECTIN FRAGMENT (1371-1382);RQDRVFHSRNSI
CAS:174063-90-2
[PHE17]-APELIN 17;H-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH
[PHE2, NLE4]-ACTH (1-24);SFS-NLE-EHFRWGKPVGKKRRPVKVYP
CAS:97773-00-7
[PHE2,ORN8]-OXYTOCIN
CAS:2480-41-3
[PHE2]-TRH
[PHE22] BIG ENDOTHELIN-1: 19-37, HUMAN
CAS:189064-07-1
[PHE4]-DERMORPHIN (1-4) AMIDE
CAS:118476-87-2
[PHE7] DYNORPHIN A: 1-7, AMIDE, PORCINE
[PHE7] DYNORPHIN A: 1-7, PORCINE
[PMP1,DTYR(OET)2,VAL4,CIT8] VASOPRESSIN
[PMP1,TYR(OET)2] AVP
[PMP1,TYR(OME)2,ARG8] VASOPRESSIN
CAS:67269-08-3
[PMP1,TYR(OME)2,ORN8] VASOTOCIN
CAS:77327-45-8
[PNO2PHE7,NLE11] SUBSTANCE P
[PRO18, ASP21] BETA-AMYLOID (17-21), IAB5;LPFFD
CAS:182912-74-9
[PRO34]-NEUROPEPTIDE Y, HUMAN, RAT: [PRO34]-NPY, HUMAN, RAT
[PRO34]-NEUROPEPTIDE Y, HUMAN, RAT;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRPRY-NH2
CAS:128768-54-7
[PRO34]-PEPTIDE YY, HUMAN;YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRPRY-NH2
CAS:179986-93-7
[PRO34]PEPTIDE YY, PYY, HUMAN
[PRO7]-NEUROKININ B
CAS:120814-48-4
[PRO9]-SUBSTANCE P;RPKPQQFFPLM-NH2
CAS:104486-69-3
[PS119] CREB327 (113-126), BIOTINYL??;BIOTIN-ILSRRP(PS)YRKILND
[PSER5]-KEMPTIDE, 5-TMR LABELED;5-TMR-LRRA-PS-LG
[PSER5]-KEMPTIDE, BIOTINYLATED, AMIDE;BIOTIN-LRRA-PS-LG-NH2
[PSER5]-KEMPTIDE, BIOTINYLATED-LC;BIOTIN-LC-LRRA-PS-LG
[PSER5]-KEMPTIDE, BIOTINYLATED;BIOTIN-LRRA-PS-LG
[PSER5]-KEMPTIDE, HILYTE FLUOR? 488 LABELED;HILYTEFLUOR?488-LRRA-PS-LG
[PSER5]-KEMPTIDE;LRRA-PS-LG
[PYR1]-APELIN-13;PYR-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH
CAS:217082-60-5
[PYR11]-AMYLOID SS-PROTEIN (11-40)
[PYR11]-BETA-AMYLOID (11-40);PYR-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV
CAS:192377-94-9
[PYR11]-BETA-AMYLOID (11-42);PYR-VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
[PYR16]-VIP (16-28) (CHICKEN)
[PYR3]-AMYLOID SS-PROTEIN (3-42)
[PYR3]-BETA-AMYLOID (3-40);PYR-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
[PYR3]-BETA-AMYLOID (3-42);PYR-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
CAS:183449-57-2
[PYR5]-SUBSTANCE P (5-11)
CAS:56104-22-4
[PYR6,PRO9]-SUBSTANCE P (6-11)
CAS:79775-19-2
[PYR6]-SUBSTANCE P (6-11)
CAS:61123-13-5
[SAR1,ALA8]-ANGIOTENSIN II
CAS:38027-95-1
[SAR1,GLY8]-ANGIOTENSIN II
[SAR1,ILE4,8]-ANGIOTENSIN II
CAS:185461-45-4
[SAR1,THR8]-ANGIOTENSIN II
CAS:53632-49-8
[SAR1,VAL5, ALA8] ANGIOTENSIN II
CAS:34273-10-4
[SAR1] ANGIOTENSIN II
CAS:102029-89-0
[SAR1]-ANGIOTENSIN I/II (1-7) AMIDE
CAS:126112-22-9
[SAR9, MET(O2)11
CAS:110880-55-2
[SAR9] SUBSTANCE P
CAS:77128-75-7
[SER102]-MCC (88-103), MCC (T102S);ANERADLIAYLKQASK
[SER2]-NEUROMEDIN C;GSHWAVGHLM-NH2
CAS:136058-54-3
[SER25]-PKC (19-31), BIOTINYLATED;K(BIOTIN)-RFARKGSLRQKNV
CAS:177966-62-0
[SER25]-PKC (19-31);RFARKGSLRQKNV
CAS:136795-05-6
[SER25]-PKC (19-36) SUBSTRATE;RFARKGSLRQKNVHEVKN
CAS:113715-84-7
[SER4,ILE8]-OXYTOCIN
CAS:550-21-0
[SER8]-GLP-1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT)
[SS-ALA70]-C3A (70-77)
[SUCCINYL-ASP6, NMEPHE8]-SUBSTANCE P (6-11), SENKTIDE;SUC-DF-(NMEF)-GLM-NH2
CAS:106128-89-6
[T-BUDSER6,: AZAGLY10]-LH-RH
CAS:145781-92-6
[THI5,8,DPHE7] BRADYKININ
CAS:97825-07-5
[THR28, NLE31]-CHOLECYSTOKININ (25-33), SULFATED;RD-Y(SO3H)-TGW-NLE-DF-NH2
[THR30]-NEUROPEPTIDE Y, HUMAN;YPSKPDNPGEDAPAEDMARYYSALRHYINTITRQRY-NH2
[THR4,GLY7] OXYTOCIN
CAS:60786-59-6
[THR46]-OSTEOCALCIN (45-49) (HUMAN)
[THR6]-BRADYKININ
CAS:6120-63-4
[TRP11] NEUROTENSIN (8-13)
[TRP11]-NEUROTENSIN
[TRP3,ARG5]-GHRELIN (1-5)
[TRP63, 64]-C3A (63-77);WWGKKYRASKLGLAR
CAS:130154-64-2
[TRP7,LEU8] LH-RH, FREE ACID
[TRP7,SS-ALA8]-NEUROKININ A (4-10)
[TRY: OME21] NEUROPEPTIDE Y, HUMAN
[TYR(OME)21]-NEUROPEPTIDE Y, HUMAN;YPSKPDNPGEDAPAEDMARYY(OME)SALRHYINLITRQRY-NH2
CAS:131256-74-1
[TYR0,DTRP8] SOMATOSTATIN
[TYR0,NLE8] PANCREASTATIN, PORCINE
[TYR0] ATRIOPEPTIN II
[TYR0] BNP (1-32), HUMAN
[TYR0] CALCITONIN GENE RELATED PEPTIDE, HUMAN
[TYR0] CALCITONIN GENE RELATED PEPTIDE, RAT
[TYR0] FIBRINOPEPTIDE A, HUMAN
CAS:103226-11-5
[TYR0] GASTRIC INHIBITORY PEPTIDE: 23-42, HUMAN
[TYR0] THYMUS FACTOR
[TYR0]-A-CALCITONIN GENE RELATED PEPTIDE, [TYR0]-A-CGRP, RAT;YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2(DISULFIDEBRIDGE:2-7)
[TYR0]-A-CGRP, [TYR0]-A-CGRP, RAT
[TYR0]-A-CGRP, HUMAN;YACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2(DISULFIDEBRIDGE:2-7)
[TYR0]-APELIN-13 (HUMAN, BOVINE, MOUSE, RAT)
[TYR0]-ATRIAL NATRIURETIC PEPTIDE (5-27), [TYR0]-ATRIOPEPTIN II, RAT;YSSCFGGRIDRIGAQSGLGCNSFR(DISULFIDEBRIDGE:4-20)
CAS:117856-13-0
[TYR0]-BNP-32 (HUMAN)
[TYR0]-C-PEPTIDE, HUMAN
CAS:57327-90-9
[TYR0]-CORTICOTROPIN RELEASING FACTOR, [TYR0]-CRF, HUMAN, RAT;YSEEPPISLDLTFHLLREVLEEMARAEQLAQQAHSNRKLMEII-NH2
CAS:100513-58-4
[TYR0]-CORTICOTROPIN RELEASING FACTOR, [TYR0]-CRF, OVINE;YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
[TYR0]-HYPERCALCEMIA MALIGNANCY FACTOR (1-40);YAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATS
[TYR0]-NEUROKININ A;YHKTDSFVGLM-NH2
[TYR0]-NEUROKININ B;YDMHDFFVGLM-NH2
[TYR0]-PTH-RELATED PROTEIN (1-34) (HUMAN, RAT)
[TYR0]-SOMATOSTATIN 28;YSANSNPAMAPRERKAGCKNFFWKTFTSC(DISULFIDEBRIDGE:18-29)
CAS:86649-84-5
[TYR0]-STRESSCOPIN (HUMAN)
[TYR0]-STRESSCOPIN-RELATED PEPTIDE (HUMAN)
[TYR1] -PTH (1-34), HUMAN
[TYR1] ADIPOKINETIC HORMONE, LOCUST
[TYR1]-DELTA-SLEEP INDUCING PEPTIDE
[TYR1]-PTH (1-34) (RAT)
[TYR1]-SOMATOSTATIN 14;YGCKNFFWKTFTSC(DISULFIDEBRIDGE:3-14)
CAS:59481-23-1
[TYR1]-TRAP-7
[TYR11] HEAD ACTIVATOR;PYR-PPGGSKVILY
[TYR11]-SOMATOSTATIN-14
[TYR12] SOMATOSTATIN 28 (1-14)
[TYR123] PREPRO ENDOTHELIN (110-130), AMIDE, HUMAN
[TYR15]-ACTH (7-15)
[TYR15]-FIBRINOPEPTIDE B
CAS:125455-56-3
[TYR19] DIAZEPAM-BINDING INHIBITOR FRAGMENT
[TYR22]-A-CGRP (22-37), RAT;YVKDNFVPTNVGSEAF-NH2
[TYR22]-A-CGRP (22-37),RAT
CAS:198277-54-2
[TYR27]-A-CGRP (27-37) (CANINE, MOUSE, RAT)
CAS:124501-79-7
[TYR27]-PTH (27-48) (HUMAN)
[TYR34]-PTH (7-34) AMIDE (BOVINE)
CAS:86292-93-5
[TYR36]-PTH-RELATED PROTEIN (1-36) (HUMAN, RAT)
[TYR38,PHE42,46]-OSTEOCALCIN (38-49) (HUMAN)
CAS:129356-77-0
[TYR4, D-PHE12]-BOMBESIN;PYR-QRYGNQWAVGFLM-NH2
CAS:108437-89-4
[TYR4]-BOMBESIN;PYR-QRYGNQWAVGHLM-NH2
CAS:67338-70-9
[TYR4]-MBP (1-11);AC-ASQYRPSQRHG
[TYR43] PTH (43-68) (HUMAN)
CAS:92952-95-9
[TYR5, D-TRP6,8,9, ARG10]-NEUROKININ A (4-10);DYWVWWR-NH2
[TYR5] BRADYKININ
[TYR52] PTH (52-84) (HUMAN)
CAS:89492-47-7
[TYR6,D-PHE7,D-HIS9]-SUBSTANCE P (6-11)
CAS:145194-26-9
[TYR63] PTH (63-84), HUMAN
[TYR65,PHE67]-C5A (65-74) (HUMAN)
[TYR69,ALA71,72,LYS74]-C3A (69-77)
[TYR8,NLE11] SUBSTANCE P
[TYR8] BRADYKININ
CAS:32222-00-7
[TYR8] SUBSTANCE P
CAS:55614-10-3
[TYR8]-ATRIAL NATRIURETIC PEPTIDE (5-27), [TYR8]-ATRIOPEPTIN II, RAT;SSCYGGRIDRIGAQSGLGCNSFR(DISULFIDEBRIDGE:3-19)
[TYR8]-ATRIAL NATRIURETIC PEPTIDE (5-27), RAT: [TYR8]-ATRIOPEPTIN II, RAT
[TYR9]- SS-MSH (PORCINE): (TYR49)-SS-LIPOTROPIN (41-58) (PORCINE)
CAS:198281-81-1
[VAL3]B-CASOMORPHIN (1-4), AMIDE, BOVINE
[VAL35] -SS - AMYLOID (1 - 42)
[VAL4] ANGIOTENSIN III
CAS:100900-28-5
[VAL438]-TYROSINASE (432-444) (HUMAN)
CAS:320341-56-8
[VAL5,ASN9]-ANGIOTENSIN I
[VAL5] ANGIOTENSIN I, HUMAN
CAS:484-43-5
[VAL5] ANGIOTENSIN II, HUMAN
CAS:58-49-1
[VAL671]-AMYLOID B/A4 PROTEIN PRECURSOR770 (667-676)
CAS:252256-43-2
[VAL8] RENIN SUBSTRATE TETRADECAPEPTIDE, RAT
|Á-SECRETASE SUBSTRATE I, FLUOROGENIC
1,6-NAPHTHYRIDINE
CAS:253-72-5
1H-PYRROLO[2,3-B]PYRIDIN-5-OL
CAS:98549-88-3
1H-PYRROLO[2,3-B]PYRIDIN-5-YLAMINE
CAS:100960-07-4
1H-PYRROLO[3,2-B]PYRIDIN-6-AMINE
CAS:1015609-67-2
2-(4-BOC-PIPERAZINYL)-2-(1-NAPHTHALENYL)ACETIC ACID
CAS:885274-72-6
2-(4-BOC-PIPERAZINYL)-2-(2-CHLORO-PHENYL)ACETIC ACID
CAS:885272-96-8
2-(4-BOC-PIPERAZINYL)-2-(2-FLUORO-PHENYL)-ACETIC ACID
CAS:444892-80-2
2-(4-BOC-PIPERAZINYL)-2-(3-FLUORO-PHENYL)-ACETIC ACID
CAS:885272-91-3
2-(4-BOC-PIPERAZINYL)-2-(3-METHOXY-PHENYL)-ACETIC ACID
CAS:868151-10-4
2-(4-BOC-PIPERAZINYL)-2-(4-METHOXY-PHENYL)-ACETIC ACID
CAS:868260-17-7
2-(METHYLTHIO)PYRIDINE-3-BORONIC ACID PINACOL ESTER
CAS:1073354-78-5
2-ADAMANTANECARBONYL-ARG-PHE-NH2
CAS:876310-60-0
2-BR-Z-OSU
CAS:128611-93-8
2-CHLORO-4-METHYL-6-METHYLSULFANYL-PYRIMIDINE
CAS:89466-59-1
2-CHLORO-D-PHE-OH.HCL
CAS:80126-50-7
2-CHLORO-PHE-OH.HCL
CAS:103616-89-3
2-CHLOROTRITYL CHLORIDE RESIN
2-CL-Z-OSU
CAS:65853-65-8
2-FLUORO-3-FORMYLPYRIDINE-4-BORONIC ACID PINACOL ESTER
CAS:1310384-06-5
2-FUROYL-LIGRLO-NH2 POTENT AND SELECTIVE PROTEASE-ACTIVATED RECEPTOR 2 (PAR2) AGONIST
CAS:729589-58-6
234 CM;KYICNSSCM
234 CW;KYMCNSSCM
26RFA, HYPOTHALAMIC PEPTIDE, FROG??NEW;VGTALGSLAEELNGYNRKKGGFSFRF-NH2
26RFA, HYPOTHALAMIC PEPTIDE, HUMAN??NEW;TSGPLGNLAEELNGYSRKKGGFSFRF-NH2
26RFA, HYPOTHALAMIC PEPTIDE, RAT??NEW;ASGPLGTLAEELSSYSRRKGGFSFRF-NH2
26S PROTEASOME REGULATORY SUBUNIT S5A (36-51) (HUMAN, MOUSE, RAT)
2837B, HEMOGLOBIN FRAGMENT, PLASMEPSIN II (PM II) SUBSTRATE, EDANS/ DABCYL??;EDANS-CO-CH2-CH2-CO-ALA-LEU-GLU-ARG-MET-PHE-LEU-SER-PHE-PRO-DAP(DABCYL)-OH
2A/2B DENGUE PROTEASE SUBSTRATE??;AC-RTSKKR-PNA
2B-(A);BIOTIN-RRAAEELDSRAGAPQL


e-Chemicals.com


Chemical Suppliers

Policy & Agreement | Privacy Policy © 2000-2017 ChemBuyersGuide.com All rights reserved