Phone (USA) +1 212-348-5610
Whatsapp: +1 516-336-9307
WeChat: chembuyersguide
Chemical Search
 


























Alfa Chemistry




Country: USA

Alfa Chemistry
New York, USA


Phone: 201-478-8534
FAX: 516-927-0118
E-Mail:E-Mail this Supplier

Contact: Brenda Randy

https://www.alfa-chemistry.com/

Alfa Chemistry

Page: Home | 1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 |
 


Product List

CIS,CIS,CIS-9-12-15 LINOLENYL ALCOHOL
Formula: C18H32O
264.44
ACM-00017875
CIS,CIS,TRANS-1,2,4-TRIMETHYLCYCLOPENTANE
CAS:4850-28-6
Formula: C8H16
112.21
ACM4850286
1,2,4-Trimethylcyclopentane;1,2,4-Trimethylcyclopentane, cis, trans;1,2cis,4trans-trimethyl-cyclopentane;1,cis-2,trans-4-Trimethylcyclopentane;cis,trans-1,2,4-trimethylcyclopentane;Cyclopentane, 1,2,4-trimethyl-, cis-1,cis-2,trans-4-;cyclopentane,1,cis-2
CIS,CIS-1,3,5-CYCLOHEXANETRICARBOXYLIC ACID
CAS:16526-68-4
Formula: C9H12O6
216.19
ACM16526684
CIS-1,3,5-CYCLOHEXANETRICARBOXYLIC ACID;CIS,CIS-1,3,5-CYCLOHEXANETRICARBOXYLIC ACID;1,3,5-CYCLOHEXANETRICARBOXYLIC ACID;(1ALPHA,3ALPHA,5ALPHA)-1,3,5-CYCLOHEXANETRICARBOXYLIC ACID;CIS,CIS-1,3,5-CYCLOHEXANETRICARBOXYLIC;1,3,5-CYCLOHEXANETRICARBOXYLIC ACID,
CIS,CIS-1,3,5-CYCLOHEXANETRICARBOXYLIC ACID
CAS:16526-68-4
Formula: C9H12O6
216.19
ACM16526684
CIS-1,3,5-CYCLOHEXANETRICARBOXYLIC ACID;CIS,CIS-1,3,5-CYCLOHEXANETRICARBOXYLIC ACID;1,3,5-CYCLOHEXANETRICARBOXYLIC ACID;(1ALPHA,3ALPHA,5ALPHA)-1,3,5-CYCLOHEXANETRICARBOXYLIC ACID;CIS,CIS-1,3,5-CYCLOHEXANETRICARBOXYLIC;1,3,5-CYCLOHEXANETRICARBOXYLIC ACID,
CIS,CIS-1,5-CYCLOOCTADIENE
CAS:1552-12-1
108.18
ACM1552121-1
CIS,CIS-1,9-CYCLOHEXADECADIENE
CAS:7431-74-5
Formula: C16H28
220.39
ACM7431745
CIS,CIS-10,13-NONADECADIENYL ALCOHOL
Formula: C19H36O
280.46
ACM-00017880
CIS,CIS-2,4-HEXADIENE-1,6-DIOL
CAS:63621-96-5
114.14
ACM63621965-1
CIS,CIS-9,12-OCTADECADIEN-1-OL
CAS:506-43-4
Formula: C18H34O
266.46
ACM506434
Linoleyl alcohol
CIS,CIS-MUCONONITRILE
CAS:1557-59-1
Formula: C6H4N2
104.11
ACM1557591
CIS,TRANS,TRANS-1,2,4-TRIMETHYLCYCLOHEXANE
CAS:1678-80-4
Formula: C9H18
126.24
ACM1678804
CIS-(+/-)-2-[(N-BENZYL-N-METHYL)AMINOMETHYL]-1-(3-METHOXYPHENYL)CYCLOHEXANOL,HYDROCHLORIDE
CAS:1018989-95-1
Formula: C22H29NO2.HCl
375.93
ACM1018989951
1-(3-Methoxyphenyl)-2-[[methyl(phenylmethyl)amino]methyl]cyclohexanol, Hydrochloride; N-Benzyl-N-demethyltramadol hydrochloride; (1R,2R)-rel-1-(3-methoxyphenyl)-2-[[methyl(phenylmethyl)amino]methyl]cyclohexanol, Hydrochloride
CIS-(2-AMINO-CYCLOPENTYL)-METHANOL
Formula: C6H13NO
115.17
ACM-00001349
CIS-[1,2-BIS(DIPHENYLPHOSPHINO)ETHANE](2-METHYLPHENYL)NICKEL(II) CHLORIDE
CAS:1256262-67-5
583.69
ACM1256262675
CIS-[2,2'-BIS(DIPHENYLPHOSPHINO)-1,1'-BINAPHTHYL](2-METHYLPHENYL)NICKEL(II) CHLORIDE
CAS:1594113-05-9
807.95
ACM1594113059
CIS-[2-(2,4-DICHLOROPHENYL)-2-(1H-IMIDAZOL-1-YLMETHYL)-1,3-DIOXALAN-4-YL]METHYL METHANE SULFONATE
CAS:61397-61-3
Formula: C15H16Cl2N2O5S
407.27
ACM61397613
cis-[2-(2,4-Dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxalan-4-yl]methyl methane sulfonate;cis-Mesylate
CIS-1,2,3,3A,4,6A-HEXAHYDROPENTALENE
CAS:930-99-4
Formula: C8H12
108.1809
ACM930994
CIS-BICYCLO(3.3.0)-2-OCTENE;1,2,3,3a,4,6a-Hexahydropentalene;Pentalene, 1,2,3,3a,4,6a-hexahydro-, cis-;cis-1,2,3,3a,4,6a-hexahydropentalene;(3aS)-1,2,3,3aa,4,6aa-Hexahydropentalene;Einecs 213-228-2
CIS-1,2,3,4-TETRAHYDRO-5-(OXIRANYLMETHOXY)-2,3-NAPHTHALENEDIOL
CAS:35697-15-5
Formula: C13H16O4
236.26
ACM35697155
Cis-1,2,3,4-Tetrahydro-5-Coxiranylmethoxy)-2,3-Naphthalenediol;Cis-1,2,3,4-Tetrahydro-5-(Oxiranylmethoxy)-2,3-Naphthalenediol
CIS-1,2,3,6-TETRAHYDROPHTHALIC ANHYDRIDE
CAS:935-79-5
Formula: C8H8O3
152.15
ACM935795
1,3-isobenzofurandion,3a,4,7,7a-tetrahydro-,cis-;3-Isobenzofurandione,3a,4,7,7a-tetrahydro-,cis-1;4,7,7a-tetrahydro-3-isobenzofurandioncis-3a;cis-3a,4,7,7a-Tetrahydro-1,3-isobenzofurandione;CIS-THPA;CIS-DELTA4-TETRAHYDROPHTHALIC ANHYDRIDE;CIS-4-TETRAHYDRO
CIS-1,2,3,6-TETRAHYDROPHTHALIC ANHYDRIDE
CAS:935-79-5
Formula: C8H8O3
152.15
ACM935795
1,3-isobenzofurandion,3a,4,7,7a-tetrahydro-,cis-;3-Isobenzofurandione,3a,4,7,7a-tetrahydro-,cis-1;4,7,7a-tetrahydro-3-isobenzofurandioncis-3a;cis-3a,4,7,7a-Tetrahydro-1,3-isobenzofurandione;CIS-THPA;CIS-DELTA4-TETRAHYDROPHTHALIC ANHYDRIDE;CIS-4-TETRAHYDRO
CIS-1,2,3,6-TETRAHYDROPHTHALIMIDE
CAS:27813-21-4
Formula: C8H9NO2
151.17
ACM27813214
CIS-1,2,3,6-TETRAHYDROPHTHALIMIDE, 5GM, NEAT;TETRAHYDROTHALIMIDE;cis-1,2,3,6-Tetrahydrophthalimide;cis-4-Cyclohexene-1,2-dicarboximide;1H-Isoindole-1,3(2H)-dione, tetrahydro-;4,5,6,7-Tetrahydroisoindole-1,3-dione;Phthalimide, tetrahydro;CIS-1,2,3,6-tetra
CIS-1,2-BIS(DIPHENYLPHOSPHINO)ETHYLENE
CAS:983-80-2
Formula: C26H22P2;
396.41g/mol
ACM983802
cis-1,2-Bis(diphenylphosphino)ethylene; cis-1,2-Bis(diphenylphosphino)ethene; A845853; dppv; [(Z)-2-diphenylphosphinoethenyl]-diphenylphosphine; AKOS002263216; NSC132588; cis-1,2-Bis(diphenylphosphino)ethylene, 97%; AB0121576; NSC132587;
CIS-1,2-BIS-(PHENYLSULFONYL)ETHYLENE
CAS:963-15-5
Formula: C14H12O4S2
308.37
ACM963155
CIS-1,2-CYCLOHEXANEDIAMINE DIHYDROCHLORIDE
CAS:10027-80-2
Formula: C6H14N2.2(HCl)
187.110640 [g/mol]
ACM10027802
cis-1,2-Cyclohexanediamine dihydrochloride;(1R,2S)-rel-1,2-Cyclohexanediamine hydrochloride
CIS-1,2-CYCLOHEXANEDIMETHANOL
CAS:15753-50-1
Formula: C8H16O2
144.21
ACM15753501
CIS-1,2-CYCLOOCTANEDIOL
CAS:27607-33-6
Formula: C8H16O2
144.21
ACM27607336
cis-1,2-Cyclooctanediol, 27607-33-6, SureCN371486, 362239_ALDRICH, CTK4F9955, ZINC16137972, 1,2-Cyclooctanediol,(1R,2S)-rel-, AKOS015915801, KB-48943, FT-0690237, I14-52876
CIS-1,2-CYCLOPENTANEDIOL
CAS:5057-98-7
Formula: C5H10O2
102.13
ACM5057987
CIS-CYCLOPENTANE-1,2-DIOL;CIS-1,2-CYCLOPENTANEDIOL;CIS-1,2-DIHYDROXYCYCLOPENTANE;TIMTEC-BB SBB008502;1,2-Cyclopentanediol, cis-;(1R,2S)-1,2-Cyclopentanediol;(1S)-Cyclopentane-1a,2a-diol;(1S,2R)-1,2-Cyclopentanediol
CIS-1,2-DI-(2-THIENYL)ETHYLENE
CAS:18266-94-9
Formula: C10H8S2
192.3
ACM18266949
trans-1,2-Di(2-thienyl)ethylene, 18266-94-9, 13640-78-3, cis-1,2-Di(2-thienyl)ethylene, 1,2-DI(2-THIENYL)ETHENE, ACMC-20alfq, AC1LCSRF, ACMC-209c5w, SureCN1801877, CTK0E8045, CTK4D8257, CTK8B0471, ANW-20034, 2-(2-thiophen-2-ylethenyl)thiophene, AG-A-09760
CIS-1,2-DICHLOROETHYLENE
CAS:156-59-2
Formula: C6H5F2N
96.94
ACM156592-1
CIS-1,2-DICYANO-1,2-BIS(2,4,5-TRIMETHYL-3-THIENYL)ETHENE
CAS:112440-46-7
Formula: C18H18N2S2
326.48
ACM112440467
CIS-1,2-DIFLUOROETHYLENE
CAS:1630-77-9
Formula: C2H2F2
64.03
ACM1630779
cis-Difluoroethene, qC`HBPt`dlpT`, (Z)-CHF=CHF, (Z)-1,2-Difluoroethylene, Ethene, 1,2-difluoro-, (Z)-, EINECS 216-628-5, CID5462921, 1630-77-9
CIS-1,2-DIHYDRO-3-METHYLCATECHOL
CAS:25506-13-2
Formula: C7H10O2
126.15
ACM25506132
CIS-(1S,2R)-3-METHYL-3,5-CYCLOHEXADIENE-1,2- DIOL;CIS-1,2-DIHYDRO-3-METHYLCATECHOL;CIS-1,2-DIHYDROXY-3-METHYLCYCLOHEXA-3,5-DIENE;20w/v%solutioninethylacetate,stab.with0.2%ea;cis-3-methyl-3,5-cyclohexadiene-1,2-diol;cis-1,2-Dihydro-3-methylcatechol,20 w/v
CIS-1,2-DIMETHYLCYCLOHEXANE
CAS:2207-01-4
112.21
ACM2207014
cis-Hexahydro-o-xylene
CIS-1,2-DIMETHYLCYCLOPENTANE
CAS:1192-18-3
Formula: C7H14
98.19
ACM1192183
CIS-1,2-DIVINYLCYCLOHEXANE
CAS:1004-84-8
Formula: C10H16
ACM1004848
CIS-1,3->O-BENZYLIDENEGLYCEROL
CAS:4141-19-9
Formula: C10H10F3IO
180.20
ACM4141199
2-Phenyl-1,3-dioxan-5-ol, cis-2-Phenyl-1,3-dioxan-5-ol, 4141-19-9, 1708-40-3, 1,3-O-Benzylideneglycerol, cis-1,3-O-Benzylideneglycerol, 1,3-Dioxan-5-ol, 2-phenyl-, (2s,5s)-2-phenyl-1,3-dioxan-5-ol, ST51038396, NSC97343, PubChem21308, AC1L2LQX, ACMC-209e1p
CIS-1,3-CYCLOHEXANEDICARBOXYLIC ACID
CAS:2305-31-9
Formula: C8H12O4
172.18
ACM2305319
CIS-1,3-DIBENZYL-2-OXO-4,5-IMIDAZOLIDINEDICARBOXYLIC ACID
CAS:51591-75-4
Formula: C19H18N2O5
354.36
ACM51591754
1,3-DIBENZYL IMIDAZOLIDINONE-2-CIS-4,5-DICARBOXYLIC ACID;1,3-DIBENZYL-2-IMIDAZOLIDONE-CIS-4,5-DICARBOXYLIC ACID;CIS-1,3-DIBENZYL-2-OXO-4,5-IMIDAZOLIDINEDICARBOXYLIC ACID;cis-1,3-dibenzyl-2-oxoimidazolidine-4,5-dicarboxylic acid;1,3-DIBENZYL-2-IMIDAZOLIDO
CIS-1,3-DIMETHYLCYCLOHEXANE
CAS:638-04-0
Formula: C8H16
112.21
ACM638040
Hexahydro-m-xylene, cis-1,3-Dimethylcyclohexane, 1,3-Dimethylcyclohexane,c&t, Cyclohexane, 1,3-dimethyl-, trans-1,3-Dimethylcyclohexane, 1,3-DIMETHYLCYCLOHEXANE, 118389_ALDRICH, MolPort-003-910-912, CID11564, NSC74161, Cyclohexane, 1,3-dimethyl-, cis-, EI
CIS-1,4-BIS(AMINOMETHYL)CYCLOHEXANE
CAS:10029-09-1
ACM10029091
CIS-1,4-CYCLOHEXANEDIOL
CAS:931-71-5
Formula: C6H12O2
116.16
ACM931715
CIS-1,4-CYCLOHEXANEDIOL;cis-cyclohexane-1,4-diol;TRANS-1,4-CYLCLOHEXANEDIOL;cis-4-cyclohexanediol;cis-Chinit;cis-Hexahydrohydroquinone;cis-Quinitol;cis-1,4-Dihydroxycyclohexane
CIS-1,4-DIBENZYLOXY-2-BUTENE
CAS:68972-96-3
Formula: C15H26O
268.35
ACM68972963-1
CIS-1,4-DIBENZYLOXY-2-BUTENE,95%
CAS:68972-96-3
Formula: C18H20O2
268.35
ACM68972963
cis-1,4-Dibenzyloxy-2-butene, AG-G-67733, 68972-96-3, SureCN1524098, 455768_ALDRICH
CIS-1,4-DICHLORO-2-BUTENE
CAS:1476-11-5
Formula: C4H6Cl2
125.00
ACM1476115
CIS-1,4-DICHLORO-2-BUTENE
CAS:1476-11-5
Formula: C4H6Cl2
125.00
ACM1476115
CIS-1,4-DIMETHYLCYCLOHEXANE
CAS:624-29-3
Formula: C7H16
112.21
ACM624293
1,4-Dimethylcyclohexane, cis-;
CIS-1,4-HEXADIENE
CAS:7318-67-4
Formula: C6H8O
82.14
ACM7318674
CIS-1,5-CYCLOOCTANEDIOL,98%
CAS:23418-82-8
Formula: C8H16O2
144.21
ACM23418828
1,5-Cyclooctanediol, cis-1,5-Cyclooctanediol, cis-Cyclooctane-1,5-diol, 1,5-Cyclooctanediol, cis-, 179035_ALDRICH, MolPort-003-927-267, MolPort-005-980-973, ZINC04528580, CID90092, EINECS 245-649-2, AN-584/42206208, 23418-82-8
CIS-1-AMINOCYCLOBUTANE-1,3-DICARBOXYLIC ACID
CAS:73550-55-7
Formula: C6H9NO4
159.14
ACM73550557
CIS-1-BROMO-1-PROPENE
CAS:590-13-6
Formula: C3H4BrCl
120.98
ACM590136
cis-1-Bromopropene, (Z)-1-Bromo-1-propene, cis-1-Bromo-1-propene, (1Z)-1-bromo-1-propene, (1Z)-1-bromoprop-1-ene, 368679_ALDRICH, 1-Propene, 1-bromo-, (Z)-, 1-propene, 1-bromo-, (1Z)-, InChI=1/C3H5Br/c1-2-3-4/h2-3H,1H3/b3-2, 590-13-6
CIS-1-BROMO-1-PROPENE
CAS:590-13-6
Formula: C3H4BrCl
120.98
ACM590136
cis-1-Bromopropene, (Z)-1-Bromo-1-propene, cis-1-Bromo-1-propene, (1Z)-1-bromo-1-propene, (1Z)-1-bromoprop-1-ene, 368679_ALDRICH, 1-Propene, 1-bromo-, (Z)-, 1-propene, 1-bromo-, (1Z)-, InChI=1/C3H5Br/c1-2-3-4/h2-3H,1H3/b3-2, 590-13-6
CIS-1-BROMO-2-ETHOXYETHYLENE
CAS:23521-49-5
Formula: C4H7BrO
151.00
ACM23521495
sGQHLLQIUfhID, Z-1-Bromo-2-ethoxyethene, cis-2-Ethoxyvinyl bromide, cis-2-Bromovinyl ethyl ether, cis-1-Bromo-2-ethoxyethylene, 02568_FLUKA, MolPort-000-139-657, NSC617631, EINECS 245-712-4, ZINC12359516, B2725G1, CID5386777, TC-068212, 23521-49-5
CIS-1-BROMO-2-ETHOXYETHYLENE
CAS:23521-49-5
Formula: C4H7BrO
151.00
ACM23521495
sGQHLLQIUfhID, Z-1-Bromo-2-ethoxyethene, cis-2-Ethoxyvinyl bromide, cis-2-Bromovinyl ethyl ether, cis-1-Bromo-2-ethoxyethylene, 02568_FLUKA, MolPort-000-139-657, NSC617631, EINECS 245-712-4, ZINC12359516, B2725G1, CID5386777, TC-068212, 23521-49-5
CIS-1-IODO-2-(HEPTAFLUOROPROPYL)CYCLOHEXANE
CAS:7589-43-7
Formula: C9H10F7I
378.07
ACM7589437
AG-H-02673, 7589-43-7, CIS-1-IODO-2-(HEPTAFLUOROPROPYL)CYCLOHEXANE, AC1MCP5K, CTK5E2162, MolPort-003-990-753, AKOS015853637, AKOS015910013, (1R,2R)-1-(heptafluoropropyl)-2-iodocyclohexane, I14-29975, (1R,2R)-1-(1,1,2,2,3,3,3-heptafluoropropyl)-2-iodocyclo
CIS-1-ISOPROPYL-2,3-DIPHENYLAZIRIDINE
CAS:71653-80-0
Formula: C17H19N
237.34
ACM71653800
CIS-1-ISOPROPYL-4-METHYLCYCLOHEXANE
CAS:6069-98-3
Formula: C10H20
140.27
ACM6069983
1-methyl-4-propan-2-ylcyclohexane
CIS-10, CIS-13-NONADECADIENOIC ACID
CAS:29204-20-4
Formula: C19H34O2
294.47
ACM29204204
10(Z),13(Z)-Nonadecadienoic acid
CIS-10, CIS-13-NONADECADIENOIC ACID ETHYL ESTER
Formula: C21H38O2
322.49
ACM-00017798
Ethyl 10(Z),13(Z)-Nonadecadienoate
CIS-10, CIS-13-NONADECADIENOIC ACID METHYL ESTER
CAS:29204-30-6
Formula: C20H36O2
308.50
ACM29204306
Methyl 10(Z),13(Z)-Nonadecadienoate
CIS-10-HEPTADECENOIC ACID
CAS:29743-97-3
Formula: C17H32O2
268.43
ACM29743973
CIS-10-HEPTADECENOL
Formula: C17H34O
254.64
ACM-00017868
CIS-10-NONADECENOIC ACID
CAS:73033-09-7
Formula: C19H36O2
296.48
ACM73033097
Nonadeca-10(Z)-enoic Acid
CIS-10-NONADECENOIC ACIDETHYL ESTER
Formula: C21H40O2
324.48
ACM-00017795
10Z-nonadecenoic acid, ethyl ester
CIS-10-NONADECENOIC ACIDMETHYL ESTER
CAS:19788-74-0
Formula: C20H38O2
310.48
ACM19788740
10Z-nonadecenoic acid, methyl ester
CIS-11,14,17-EICOSATRIENOIC ACID
CAS:2091-27-2
Formula: C20H34O2
306.53
ACM2091272
Eicosa-11Z,14Z,17Z-trienoic acid
CIS-11,14,17-EICOSATRIENOIC ACID
CAS:2091-27-2
Formula: C20H34O2
306.53
ACM2091272
Eicosa-11Z,14Z,17Z-trienoic acid
CIS-11,14,17-EICOSATRIENOIC ACID ETHYL ESTER
CAS:99660-95-4
Formula: C22H38O2
334.50
ACM99660954
Ethyl icosa-11,14,17-trienoate
CIS-11,14,17-EICOSATRIENOIC ACID METHYL ESTER
CAS:55682-88-7
Formula: C21H36O2
320.53
ACM55682887
methyl cis-11,14,17-eicosatrienoate
CIS-11,14-EICOSADIENOIC ACID
CAS:2091-39-6
Formula: C20H36O2
308.53
ACM2091396
11(Z),14(Z)-Eicosadienoic Acid
CIS-11,14-EICOSADIENOIC ACID ETHYL ESTER
CAS:103213-62-3
Formula: C22H40O2
336.55
ACM103213623
103213-62-3, 11,14-Eicosadienoicacid, ethyl ester, (11Z,14Z)-, cis-11,14-Eicosadienoic acid ethyl ester, Ethyl Icosa-11,14-dienoate, AC1NNCKE, ACMC-20m63b, CTK4A1879, CTK8E5743, AG-D-13697, 11,14-Eicosadienoicacid, ethyl ester, (Z,Z)-
CIS-11,14-EICOSADIENOIC ACID ETHYL ESTER
CAS:103213-62-3
Formula: C22H40O2
336.55
ACM103213623
103213-62-3, 11,14-Eicosadienoicacid, ethyl ester, (11Z,14Z)-, cis-11,14-Eicosadienoic acid ethyl ester, Ethyl Icosa-11,14-dienoate, AC1NNCKE, ACMC-20m63b, CTK4A1879, CTK8E5743, AG-D-13697, 11,14-Eicosadienoicacid, ethyl ester, (Z,Z)-
CIS-11,14-EICOSADIENOIC ACID METHYL ESTER
CAS:61012-46-2
Formula: C21H38O2
322.54
ACM61012462
11(Z),14(Z)-Eicosadienoic Acid methyl ester
CIS-11,14-TRIEICOSADIENOIN
Formula: C63H110O6
963.54
ACM-00017842
Trieicosadienoin
CIS-11-EICOSENAMIDE
CAS:10436-08-5
Formula: C20H39NO
309.53
ACM10436085
CIS-11-EICOSENOIC ACID
CAS:5561-99-9
Formula: C20H38O2
310.54
ACM5561999
11(Z)-Eicosenoic Acid
CIS-11-EICOSENOIC ACID
CAS:5561-99-9
Formula: C20H38O2
310.54
ACM5561999
11(Z)-Eicosenoic Acid
CIS-11-EICOSENOIC ACIDETHYL ESTER
Formula: C22H42O2
338.57
ACM-00017805
Ethyl cis-11-eicosenoate
CIS-11-EICOSENOIC ACIDMETHYL ESTER
CAS:2390-09-2
Formula: C21H40O2
324.54
ACM2390092-1
Methyl cis-11-eicosenoate
CIS-11-METHYL-2-DODECENOIC ACID
CAS:677354-23-3
Formula: C13H24O2
212.33
ACM677354233
AGN-PC-0092BQ, CTK1H6767, CTK8E7235, (E)-11-methyldodec-2-enoic acid, 677354-23-3, AG-G-56573, trans-delta2-11-methyl-Dodecenoic Acid, 2-Dodecenoic acid, 11-methyl-, (2Z)-, trans-.DELTA.2-11-methyl-Dodecenoic Acid, 677354-24-4
CIS-11-OCTADECENOIC ACID
CAS:506-17-2
Formula: C18H34O2
282.50
ACM506172
11Z-octadecenoic acid
CIS-11-OCTADECENOIC ACID
CAS:506-17-2
Formula: C18H34O2
282.50
ACM506172
11Z-octadecenoic acid
CIS-11-OCTADECENOIC ACID METHYL ESTER
CAS:1937-63-9
Formula: C19H36O2
296.49
ACM1937639
CIS-11-OCTADECENOIC ACIDETHYL ESTER
Formula: C20H38O2
310.50
ACM-00017789
11Z-Octadecenoic acid ethyl ester
CIS-11-OCTADECENOIC ACIDMETHYL ESTER
CAS:1937-63-9
Formula: C19H36O2
296.50
ACM1937639-1
Methyl cis-Vaccenate
CIS-12,15-HENEICOSADIENOIC ACID
CAS:191545-08-1
Formula: C21H38O2
322.53
ACM191545081
12(Z),15(Z)-Heneicosadienoic Acid
CIS-12,15-HENEICOSADIENOIC ACID ETHYL ESTER
Formula: C23H42O2
350.55
ACM-00017812
12(Z),15(Z)-Heneicosadienoic Acid ethyl ester
CIS-12,15-HENEICOSADIENOIC ACID METHYL ESTER
Formula: C22H40O2
336.55
ACM-00017811
12(Z),15(Z)-Heneicosadienoic Acid methyl ester
CIS-12-OCTADECENOIC ACID METHYL ESTER
CAS:2733-86-0
Formula: C19H36O2
296.50
ACM2733860
Methyl (12Z)-octadec-12-enoate
CIS-13,16,19-DOCOSATRIENOIC ACID
CAS:28845-86-5
Formula: C22H38O2
334.58
ACM28845865
Docosatrienoic Acid;13Z,16Z,19Z-docosatrienoic acid
CIS-13,16,19-DOCOSATRIENOIC ACID ETHYL ESTER
Formula: C24H42O2
362.56
ACM-00017810
Docosatrienoic Acid ethyl ester
CIS-13,16,19-DOCOSATRIENOIC ACID METHYL ESTER
CAS:108698-01-7
Formula: C23H40O2
348.56
ACM108698017
Docosatrienoic Acid methyl ester
CIS-13,16,19-DOCOSATRIENOIC ACID METHYL ESTER
CAS:108698-01-7
Formula: C23H40O2
348.56
ACM108698017
Docosatrienoic Acid methyl ester
CIS-13,16-DOCOSADIENOIC ACID
CAS:17735-98-7
Formula: C22H40O2
336.55
ACM17735987
13Z,16Z-Docosadienoic Acid
CIS-13,16-DOCOSADIENOIC ACID ETHYL ESTER
Formula: C24H44O2
364.58
ACM-00017809
Docosadienoic Acid ethyl ester
CIS-13,16-DOCOSADIENOIC ACID METHYL ESTER
CAS:61012-47-3
Formula: C23H42O2
350.58
ACM61012473
Docosadienoic Acid methyl ester
CIS-13,16-DOCOSADIENOIC ACID METHYL ESTER
CAS:61012-47-3
Formula: C23H42O2
350.58
ACM61012473
Docosadienoic Acid methyl ester
CIS-13,16-DOCOSADIENOL
Formula: C22H42O
322.54
ACM-00017886
CIS-13-DOCOSEN-1-OL
CAS:629-98-1
Formula: C22H44O
324.58
ACM629981
Erucyl alcohol
CIS-13-DOCOSENOIC ACID
CAS:112-86-7
Formula: C22H42O2
338.59
ACM112867
13(Z)-Docosenoic Acid
CIS-13-DOCOSENOIC ACIDETHYL ESTER
CAS:37910-77-3
Formula: C24H46O2
366.62
ACM37910773
Erucic Acid Ethyl Ester
CIS-13-DOCOSENOIC ACIDMETHYL ESTER
CAS:1120-34-9
Formula: C23H44O2
352.59
ACM1120349
Methyl cis-13-Docosenoate
CIS-13-EICOSENOIC ACID
CAS:17735-94-3
Formula: C20H38O2
310.51
ACM17735943
CIS-13-EICOSENOIC ACID METHYL ESTER
CAS:69120-02-1
Formula: C21H40O2
324.54
ACM69120021
cis-13-Eicosenoic acid methyl ester, AG-G-68682, 69120-02-1, E3512_SIGMA
CIS-14-TRICOSENOIC ACID
CAS:105305-00-8
Formula: C23H44O2
352.59
ACM105305008
14(Z)-Tricosenoic acid
CIS-14-TRICOSENOIC ACID METHYL ESTER
CAS:50995-25-0
Formula: C24H46O2
366.62
ACM50995250
Methyl 14(Z)-Tricosenoate
CIS-14-TRICOSENOIC ACIDETHYL ESTER
Formula: C25H48O2
380.59
ACM-00017813
Ethyl 14(Z)-Tricosenoate
CIS-14-TRICOSENOL
Formula: C23H46O
338.60
ACM-00017890
CIS-15-TETRACOSENOIC ACID
CAS:506-37-6
Formula: C24H46O2
366.60
ACM506376
Selacholeic acid
CIS-15-TETRACOSENOIC ACIDETHYL ESTER
Formula: C26H50O2
394.60
ACM-00017814
Ethyl cis-15-tetracosenoate
CIS-15-TETRACOSENOIC ACIDMETHYL ESTER
CAS:2733-88-2
Formula: C25H48O2
380.65
ACM2733882-1
Methyl cis-15-tetracosenoate
CIS-2,3-EPOXYBUTANE
CAS:1758-33-4
Formula: C4H8O
72.11
ACM1758334
(2S,3R)-2,3-Dimethyl-oxirane;2,3-Dimethyl-oxirane (Z);3-dimethyl-cis-oxiran;3-epoxy-cis-butan;Butane, 2,3-epoxy-, cis-;cis-2,3-dimethyloxirane;cis-2-Butene Epoxide;cis-2-Butene Oxide
CIS-2,4,5-TRIMETHOXY-1-PROPENYLBENZENE
CAS:5273-86-9
208.25
ACM5273869
CIS-2,5-BISHYDROXYMETHYL-TETRAHYDROFURAN
CAS:2144-40-3
Formula: C6H12O3
ACM2144403
CIS-2,5-DIMETHYL-3-HEXENE
CAS:26266-69-3
Formula: C8H16
112.21
ACM26266693
CIS-2,5-DIMETHYL-3-HEXENE;2,5-DIMETHYL-3-HEXENE;TRANS-2,5-DIMETHYL-3-HEXENE
CIS-2,5-DIMETHYL-3-HEXENE
CAS:26266-69-3
Formula: C8H16
112.21
ACM26266693
CIS-2,5-DIMETHYL-3-HEXENE;2,5-DIMETHYL-3-HEXENE;TRANS-2,5-DIMETHYL-3-HEXENE
CIS-2,5-DIMETHYLOXOLANE
CAS:2144-41-4
0
ACM2144414
cis-2,5-Dimethyloxolane;CIS-2,5-DIMETHYLTETRAHYDROFURAN;CIS-2,5-DIMETHYLTERAHYDROFURAN
CIS-2- AMINO-3-CYCLOPENTENE-1-CARBOXYLIC ACID HYDROCHLORIDE
CAS:122022-92-8
Formula: C6H10ClNO2
163.60
ACM122022928
cis-2- Amino-3-cyclopentene-1-carboxylic acid hydrochloride, 122022-92-8, ACMC-20alfg, SureCN825748
CIS-2- AMINO-3-CYCLOPENTENE-1-CARBOXYLIC ACID HYDROCHLORIDE
CAS:122022-92-8
Formula: C6H10ClNO2
163.60
ACM122022928
cis-2- Amino-3-cyclopentene-1-carboxylic acid hydrochloride, 122022-92-8, ACMC-20alfg, SureCN825748
CIS-2-(4-METHYLBENZOYL)-1-CYCLOHEXANECARBOXYLIC ACID,99
CAS:107147-13-7
Formula: C15H18O3
246.30162
ACM107147137
CIS-2-(TERT-BUTOXYCARBONYLAMINO)-1-CYCLOPENTANECARBOXYLIC ACID
CAS:136315-70-3
Formula: C11H19NO4
229.274
ACM136315703
CIS-2-AMINO-1-CYCLOHEXANECARBOXAMIDE
CAS:115014-77-2
Formula: C7H14N2O
178.66
ACM115014772
ZINC02516844, CID7015732, 115014-77-2
CIS-2-AMINO-2-METHYL-CYCLOHEXANECARBOXYLIC ACID HYDROCHLORIDE
CAS:202921-88-8
Formula: C8H15NO2•HCl
193.67
ACM202921888
202921-88-8, cis-2-Amino-2-methyl-cyclohexanecarboxylic acid hydrochloride, cis-2-Amino-2-methylcyclohexanecarboxylic acid hydrochloride, 30254_ALDRICH, 30254_FLUKA, CTK8F0571, AB22652, (1R,2S/1S,2R)-2-AMINO-2-METHYLCYCLOHEXANECARBOXYLIC ACID
CIS-2-AMINO-2-METHYL-CYCLOPENTANECARBOXYLIC ACID HYDROCHLORIDE
CAS:156292-34-1
Formula: C7H14ClNO2
179.64
ACM156292341
cis-2-Amino-2-methylcyclopentanecarboxylic acid hydrochloride, CHEMBL542738, 156292-34-1
CIS-2-AMINO-4-CYCLOHEXENE-1-CARBOXAMIDE
Formula: C7H11N3O2
140.18
ACM-00001461
CIS-2-AMINO-CYCLOHEX-3-ENECARBOXYLIC ACID HYDROCHLORIDE
Formula: C7H17NO2
177.63
ACM-00001419
CIS-2-AMINO-CYCLOHEX-3-ENECARBOXYLIC ACID HYDROCHLORIDE
CAS:142035-00-5
Formula: C7H12ClNO2
177.62868
ACM142035005
CIS-2-AMINO-CYCLOPENTANOL HYDROCHORIDE
Formula: C5H11NO2
137.61
ACM-00001220
CIS-2-AMINOCYCLOHEXANECARBOXYLIC ACID
CAS:45743-49-5
Formula: C7H13NO2
143.18
ACM45743495
cis-2-Aminocyclohexanecarboxylic acid, CIS-2-AMINO-1-CYCLOHEXANECARBOXYLIC ACID, 5691-20-3, cis-2-aminocyclohexane-1-carboxylic acid, AC1MC5CW, SureCN48276, 07617_FLUKA, CTK0H1393, MolPort-002-054-029, AB03883, AG-F-58328, AG-G-00243, cis-2-Amino-1-cycloh
CIS-2-AMINOMETHYL-1-CYCLOHEXANOL HYDROCHLORIDE
Formula: C7H15NO
165.66
ACM-00001437
CIS-2-BROMOVINYLBORONIC ACID MIDA ESTER
CAS:1105069-27-9
ACM1105069279
CIS-2-BUTENE-1,4-DIOL
CAS:6117-80-2
Formula: C4H8O2
88.11
ACM6117802
CIS-2-DECENOIC ACID
CAS:15790-91-7
Formula: C10H18O2
270.25
ACM15790917
2-Decensaeure; Dec-2-en-saeure; Decensaeure; 2Z-decenoic acid; dec-2-enoic acid; C10:1n-8; cis-dec-2-enoic acid; 1-nonenylcarboxylic acid; 2-cis-decenoic acid;
CIS-2-DECENOIC ACID
CAS:15790-91-7
Formula: C10H18O2
270.25
ACM15790917
2-Decensaeure; Dec-2-en-saeure; Decensaeure; 2Z-decenoic acid; dec-2-enoic acid; C10:1n-8; cis-dec-2-enoic acid; 1-nonenylcarboxylic acid; 2-cis-decenoic acid;
CIS-2-HEPTENE
CAS:6443-92-1
Formula: C7H14
98.19
ACM6443921
CIS-2-HEXEN-1-OL
CAS:928-94-9
Formula: C6H12O
100.16
ACM928949
CIS-2-HEXENAL
CAS:16635-54-4
Formula: C6H10O
98.143
ACM16635544
Cis-2-Hexenal
CIS-2-HEXENE
CAS:7688-21-3
Formula: C6H12
84.16
ACM7688213
(2Z)-2-Hexene;(Z)-2-C6H12;(Z)-2-Hexene;2-Hexene, cis-;cis-hex-2-ene;CIS-2-HEXENE;(Z)-hex-2-ene;cis-2-Hexene,95%
CIS-2-HYDROXYMETHYL-1-CYCLOHEXYLAMINE HYDROCHLORIDE
Formula: C7H15NO2
165.66
ACM-00001436
CIS-2-IODOVINYLBORONIC ACID MIDA ESTER
CAS:1260506-59-9
ACM1260506599
CIS-2-METHYL-7-OCTADECENE
CAS:35354-39-3
Formula: C19H38
266.51
ACM35354393
CIS-2-METHYLCYCLOHEXANOL
CAS:7443-70-1
Formula: C7H14O
114.19
ACM7443701
CIS-2-NONEN-1-OL
CAS:41453-56-9
Formula: C9H18O
142.24
ACM41453569
(Z)-2-Nonen-1-ol
CIS-2-PENTEN-1-OL
CAS:1576-95-0
Formula: C5H10O
86.13
ACM1576950
cis-2-Penten-1-ol, 2-Penten-1-ol, (Z)-, cis-Pent-2-ene-1-ol, (Z)-2-Penten-1-ol, (Z)-Pent-2-en-1-ol, 2-Penten-1-ol, (2Z)-, 304182_ALDRICH, ZINC05224689, EINECS 216-415-7, LMFA05000110, CID5364919, FS000334, 1576-95-0
CIS-2-PENTENE
CAS:627-20-3
Formula: C5H10
70.13
ACM627203
CIS-2-AMYLENE;CIS-2-PENTENE;CIS-PENTENE-2;(2Z)-2-Pentene;(z)-2-penten;(Z)-2-Pentene;.beta.-cis-Amylene;2-(Z)-C5H10
CIS-2-PENTENENITRILE
CAS:25899-50-7
Formula: C5H7N
81.13
ACM25899507
(z)-2-pentenenitril;(Z)-2-Pentenenitrile;1-cyano-1-butene;2-Pentenenitrile, (Z)-;cis-1-butenylcyanide;cis-pent-2-enenitrile;2-PENTENENITRILE;1-BUTEN-1-YL CYANIDE
CIS-2-TERT-BUTOXYCARBONYLAMINO-CYCLOHEPTANECARBOXYLIC ACID
CAS:1212407-62-9
Formula: C13H23NO4
257.33
ACM1212407629
1212407-62-9, cis-2-Tert-butoxycarbonylamino-cycloheptanecarboxylic acid, CTK8F1599, MolPort-006-170-518, AB50598, AK-55253, (1R,2S)-2-((tert-Butoxycarbonyl)amino)cycloheptanecarboxylic acid, (1R,2S)-2-[(tert-butoxycarbonyl)amino]cycloheptane-1-carboxylic
CIS-2-TERT-BUTOXYCARBONYLAMINO-CYCLOOCTANECARBOXYLIC ACID
CAS:1013980-15-8
Formula: C14H25NO4
271.35
ACM1013980158
2-{[(tert-butoxy)carbonyl]amino}cyclooctane-1-carboxylic acid, cis-2-Tert-butoxycarbonylamino-cyclooctanecarboxylic acid, AGN-PC-01A9BD, 1013980-15-8, MCULE-5668723566, RP29645, (1R,2S)-2-[(2-methylpropan-2-yl)oxycarbonylamino]cyclooctane-1-carboxylic aci
CIS-2-TERT-BUTOXYCARBONYLAMINOCYCLOPENT-3-ENE-1-CARBOXYLIC ACID
CAS:959746-05-5
Formula: C11H17NO4
227.26
ACM959746055
959746-05-5, cis-2-tert-Butoxycarbonylaminocyclopent-3-ene-1-carboxylic acid
CIS-3,4-DICHLOROCYCLOBUTENE
CAS:2957-95-1
122.98
ACM2957951
CIS-3,7-DIMETHYL-2,6-OCTADIEN-1-OL
CAS:106-25-2
Formula: C10H18O
154.25
ACM106252
CIS-3-(2-CHLORO-3,3,3-TRIFLUORO-1-PROPENYL)-2,2-DIMETHYL-CYCLOPROPANECARBOXYLIC ACID
CAS:72748-35-7
Formula: C9H10ClF3O2
242.62
ACM72748357
Lambda-cyhalothric acid
CIS-3-AMINOCYCLOHEXANOL HYDROCHLORIDE
CAS:124555-44-8
Formula: C6H14ClNO
151.634460 [g/mol]
ACM124555448
cis-3-aminocyclohexanol hydrochloride, 124555-44-8, PubChem19468, SureCN2145087
CIS-3-BENZYLOXYMETHYLCYCLOBUTANOL
CAS:172324-68-4
Formula: C12H16O2
192.25
ACM172324684
CIS-3-BOC-AMINO-TETRAHYDROPYRAN-4-CARBOXYLIC ACID
CAS:1006891-33-3
Formula: C11H19NO5
245.27
ACM1006891333
cis-3-Boc-Amino-tetrahydropyran-4-carboxylic acid, 1006891-33-3, CTK8F0166, ACT05157, cis-3-tert-Butoxycarbonylamino-tetrahydro-pyran-4-carboxylic acid, cis-3-(tert-butoxycarbonylamino)tetrahydro-2H-pyran-4-carboxylic acid
CIS-3-BOC-AMINOCYCLOBUTANECARBOXYLIC ACID
CAS:1008773-79-2
Formula: C10H17NO4
215.25
ACM1008773792
CIS-3-BOC-AMINOCYCLOBUTANECARBOXYLIC ACID;CIS-3-(TERT-BUTOXYCARBONYLAMINO)CYCLOBUTANECARBOXYLIC ACID
CIS-3-FLUOROCYCLOPENTANAMINE TRIFLUOROACETATE SALT
CAS:1154870-58-2
Formula: C7H11F4NO2
217.16
ACM1154870582
(1R,3S)-rel-3-Fluorocyclopentanamine Trifluoroacetate;
CIS-3-HEXEN-1-OL
CAS:928-96-1
Formula: C6H12
100.16
ACM928961
CIS-3-HEXEN-1-YL 2-OCTYNOATE
CAS:68698-58-8
Formula: C14H22O2
222.32
ACM68698588
CIS-3-HEXENE
CAS:7642-09-3
Formula: C6H12
84.16
ACM7642093
(3Z)-3-Hexene;(Z)-3-C6H12;(Z)-3-Hexene;3-hexene,(Z)-;cis-hex-3-ene;CIS-3-HEXENE;cis-3-hexene93+%;cis-3-Hexene, pure, 97%
CIS-3-HEXENYL CIS-3-HEXENOATE
CAS:61444-38-0
Formula: C12H20O2
196.29
ACM61444380
CIS-3-HEXENYL CYCLOPROPYL FORMATE
CAS:188570-78-7
Formula: C10H16O2
168.23284
ACM188570787
CIS-3-METHOXY-4-AMINOPIPERIDINE
CAS:766556-99-4
Formula: C6H14N2O
130.19
ACM766556994
CIS-3-METHOXY-4-AMINOPIPERIDINE
CIS-3-METHYL-2-PENTENE
CAS:922-62-3
Formula: C6H12
84.16
ACM922623
CIS-3-METHYL-2-PENTENE;(2Z)-3-Methyl-2-pentene;(Z)-3-Methyl-2-pentene;(Z)-CH3CH=C(CH3)C2H5;3-Methyl-2-pentene, cis;3-Methyl-cis-2-pentene;cis-3-methyl-pent-2-ene;(Z)-3-methylpent-2-ene
CIS-3-METHYLCYCLOHEXANOL
CAS:24965-90-0
Formula: C7H14O
114.19
ACM24965900
CIS-3-NONEN-1-OL
CAS:10340-23-5
Formula: C9H18O
142.24
ACM10340235
(3Z)-3-Nonene-1-ol
CIS-3-NONEN-1-OL
CAS:10340-23-5
Formula: C9H18O
142.24
ACM10340235
(3Z)-3-Nonene-1-ol
CIS-4,7,10,13,16,19-DOCOSAHEXAENOIC ACID
CAS:6217-54-5
Formula: C22H32O2
328.49
ACM6217545
Docosahexaenoic Acid;Cervonic Acid
CIS-4,7,10,13,16,19-DOCOSAHEXAENOIC ACID ETHYL ESTER
CAS:84494-72-4
Formula: C24H36O2
356.54
ACM84494724
Docosahexaenoic acid ethyl ester
CIS-4,7,10,13,16,19-DOCOSAHEXAENOIC ACID METHYL ESTER
CAS:2566-90-7
Formula: C23H34O2
342.51
ACM2566907-1
Cervonic Acid methyl ester
CIS-4-(2,2,3-TRIMETHYLCYCLOPENTYL)BUTANOIC ACID
CAS:957136-80-0
Formula: C12H22O2
198
ACM957136800
cis-4-(2,2,3-Trimethylcyclopentyl)butanoic acid;4-(2,2,3-Trimethylcyclopentyl)butanoic acid
CIS-4-(4-CHLOROPHENYL)CYCLOHEXANECARBOXYLIC ACID
CAS:1346600-43-8
Formula: C13H15ClO2
238.71
ACM1346600438
cis-4-(4-Chlorophenyl)cyclohexanecarboxylic Acid;Atovaquone Related Compound 1
CIS-4-(BOC-AMINO)CYCLOHEXANECARBOXYLIC ACID
CAS:53292-90-3
Formula: C12H21NO4
243.3
ACM53292903
53292-89-0, Boc-1,4-Trans-ACHC-OH, trans-4-(Boc-amino)cyclohexanecarboxylic acid, 53292-90-3, 130309-46-5, cis-4-(tert-Butoxycarbonylamino)cyclohexanecarboxylic Acid, Boc-trans-4-Aminocyclohexanecarboxylic acid, cis-4-(Boc-amino)cyclohexanecarboxylic acid
CIS-4-AMINO-1-BOC-PYRROLIDINE-3-CARBOXYLIC ACID
CAS:492462-02-9
0
ACM492462029
cis-4-Amino-1-Boc-pyrrolidine-3-carboxylic acid;CIS-4-AMINO-1-BOC-PYRROLIDINE-3-CARBOXYLIC;(3R,4R)-4-AMino-1-(tert-butoxycarbonyl)pyrrolidine-3-carboxylic acid
CIS-4-AMINO-CYCLOHEXANOL HYDROCHLORIDE
Formula: C6H14ClN
151.63
ACM-00001343
CIS-4-AMINOCROTONIC ACID
CAS:55199-25-2
Formula: C4H7N1O2
101.1
ACM55199252
CIS-4-AMINOCROTONIC ACID (CACA) \ GABAC RECEPTOR AGONIST;4-Amino-cis-2-butenoicacid,CACA
CIS-4-AMINOCYCLOHEXANECARBOXYLIC ACID
CAS:3685-23-2
Formula: C7H13NO2
143.18
ACM3685232
CIS-4-AMINOMETHYLCYCLOHEXANE-1-CARBOXYLIC ACID
CAS:1197-17-7
Formula: C8H15NO2
0
ACM1197177
cis-4-aminomethylcyclohexane-1-carboxylic acid;cis-TranexaMic Acid;cis-4-(AMinoMethyl)cyclohexanecarboxylic acid;cis-4-(Aminomethyl)-1-cyclohexanecarboxylic acid;cis-AMCHA;Tranexamic EP Impurity B
CIS-4-BENZYLOXY-2-BUTEN-1-OL
CAS:81028-03-7
Formula: C11H14O2
178.23
ACM81028037
CIS-4-CARBOMETHOXY-CYCLOHEXANE-1-CARBOXYLIC ACID
CAS:1011-85-4
Formula: C9H14O4
186.205060 [g/mol]
ACM1011854
15177-67-0, TRANS-1,4-CYCLOHEXANEDICARBOXYLIC ACID MONOMETHYL ESTER, 1011-85-4, 32529-79-6, cis-4-(Methoxycarbonyl)cyclohexanecarboxylic acid, 4-(methoxycarbonyl)cyclohexanecarboxylic acid, 4-Carbomethoxy-cyclohexane-1-carboxylic acid, SBB059422, (1r,4r)-
CIS-4-CHLORO-2-BUTENYLAMINE HYDROCHLORIDE
CAS:7153-66-4
Formula: ClCH2CH=CHCH2NH2.HCl
142.03
ACM7153664
423432_ALDRICH, MolPort-003-932-502, NSC51333, cis-4-Chloro-2-butenylamine hydrochloride, 7153-66-4
CIS-4-CHLORO-2-BUTENYLAMINE HYDROCHLORIDE
CAS:7153-66-4
Formula: ClCH2CH=CHCH2NH2.HCl
142.03
ACM7153664
423432_ALDRICH, MolPort-003-932-502, NSC51333, cis-4-Chloro-2-butenylamine hydrochloride, 7153-66-4
CIS-4-DECEN-1-OL
CAS:57074-37-0
Formula: C10H20O
156.27
ACM57074370
CIS-4-DECEN-1-OL;
CIS-4-DECENOYL CARNITINE
CAS:98930-66-6
0
ACM98930666
cis-4-Decenoyl carnitine
CIS-4-FLUORO-D-PROLINE;(2R,4R)-4-FLUOROPYRROLIDINE-2-CARBOXYLIC ACID
CAS:913820-71-0
133.12
ACM913820710
CIS-4-FLUORO-L-PROLINE HYDROCLORIDE;(2S,4S)-4-FLUOROPYRROLIDINE-2-CARBOXYLIC ACID HYDROCLORIDE
CAS:1001354-51-3
Formula: C5H9ClFNO2
169.58
ACM1001354513
(2S,4S)-4-Fluoropyrrolidine-2-carboxylic acid hydrochloride, 1001354-51-3, SCHEMBL1269322, MolPort-035-706-666, AKOS024464364, AK162679
CIS-4-HEPTEN-1-AL;4-HEPTENAL
CAS:62238-34-0
Formula: C7H12O
112.17
ACM62238340
4-Heptenal, cis-4-Hepten-1-al, CID71590, ZINC06661796, 62238-34-0, 6728-31-0
CIS-4-HEXEN-1-OL
CAS:928-91-6
100.16
ACM928916
CIS-4-HYDROXY-PIPERIDINE-1,2-DICARBOXYLIC ACID1-TERT-BUTYL ESTER 2-METHYL ESTER
CAS:181269-87-4
Formula: C12H21NO5
259.29884
ACM181269874
CIS-4-METHYL-2-PENTENE
CAS:691-38-3
Formula: C6H12
84.16
ACM691383
4-METHYL-2-PENTENE;CIS-4-METHYL-2-PENTENE;TRANS-4-METHYLPENTENE-2;TRANS-4-METHYL-2-PENTENE;(Z)-4-METHYL-2-PENTENE;(2Z)-4-Methyl-2-pentene;(Z)-(CH3)2CHCH=CHCH3;4-Methyl-2-cis-pentene
CIS-4-METHYLCYCLOHEXANOL
CAS:7731-28-4
Formula: C7H14O
114.19
ACM7731284
CIS-4-NONENE
CAS:10405-84-2
Formula: C9H18
126.24
ACM10405842
CIS-4-OCTENE
CAS:7642-15-1
Formula: C8H16
112.22
ACM7642151
CIS-5,8,11,14,17-EICOSAPENTAENOIC ACID
CAS:10417-94-4
Formula: C20H30O2
302.52
ACM10417944
Timnodonic Acid
CIS-5,8,11,14,17-EICOSAPENTAENOIC ACID METHYL ESTER
CAS:2734-47-6
Formula: C21H32O2
316.48
ACM2734476
CIS-5,8,11,14,17-EICOSAPENTAENOIC ACIDETHYL ESTER
CAS:86227-47-6
Formula: C22H34O2
330.52
ACM86227476
Eicosapentaenoic acid ethyl ester
CIS-5,8,11,14,17-EICOSAPENTAENOIC ACIDMETHYL ESTER
CAS:2734-47-6
Formula: C21H32O2
316.50
ACM2734476-1
EPA methyl ester
CIS-5,8,11,14-EICOSATETRAENOIC ACID
CAS:506-32-1
Formula: C20H32O2
304.50
ACM506321
Arachidonic acid
CIS-5,8,11,14-EICOSATETRAENOIC ACID ETHYL ESTER
CAS:95285-77-1
Formula: C22H36O2
332.52
ACM95285771
5,8,11,14-Eicosatetraenoic acid, ethyl ester
CIS-5,8,11,14-EICOSATETRAENOIC ACIDMETHYL ESTER
CAS:2566-89-4
Formula: C21H34O2
318.52
ACM2566894
Methyl arachidonate
CIS-5-DECENE
CAS:7433-78-5
Formula: C10H20
140.27
ACM7433785
CIS-5-DODECENOIC ACID
CAS:2430-94-6
Formula: C12H22O2
198.30
ACM2430946
CIS-5-EICOSENOIC ACID
CAS:7050-07-9
Formula: C20H38O2
310.54
ACM7050079
5(Z)-Eicosenoic acid
CIS-5-EICOSENOIC ACIDETHYL ESTER
Formula: C22H42O2
338.57
ACM-00017807
(Z)-5-Icosenoic acid ethyl ester
CIS-5-EICOSENOIC ACIDMETHYL ESTER
Formula: C21H40O2
324.54
ACM-00017806
(Z)-5-Icosenoic acid methyl ester
CIS-5-NORBORNENE-ENDO-2,3-DICARBOXYLIC ACID
CAS:3853-88-1
Formula: C9H10O4
182.17
ACM3853881
NORBORNYLENE-2,3-DICARBOXYLIC ACID;3,6-ENDOMETHYLENE-1,2,3,6-TETRAHYDROPHTHALIC ACID;CIS,ENDO-5-NORBORNENE-2,3-DICARBOXYLIC ACID;CIS,ENDO-BICYCLO[2.2.1]-5-HEPTENE-2,3-DICARBOXYLIC ACID;CIS-5-NORBORNENE-ENDO-2,3-DICARBOXYLIC ACID;EXO,EXO BICYCLO(2.2.1)HEPT
CIS-5-NORBORNENE-EXO-2,3-DICARBOXYLIC ANHYDRIDE
CAS:2746-19-2
Formula: C9H8O3
164.16
ACM2746192
CIS-5-NORBORNENE-EXO-2,3-DICARBOXYLIC ANHYDRIDE;BICYCLO[2.2.1]HEPT-5-ENE-EXO-2,3-DICARBOXYLIC ANHYDRIDE;(1a,2a,3,6{f1b})-1,2,3,6-tetrahydro-3,6-methanophthalicanhydride;(3at,7at)-3a,4,7,7a-tetrahydro-4r,7c-methano-isobenzofuran-1,3-dione;3at,7at-3a,4,7,7
CIS-6,9,12,15-OCTADECATETRAENOIC ACID*SO DIUM
CAS:115610-41-8
ACM115610418
CIS-6,CIS-9,CIS-12 OCTADECADIENOIC ACID ETHYL ESTER
CAS:31450-14-3
Formula: C20H34O2
306.50
ACM31450143
6,9,12-Octadecatrienoic acid ethyl ester
CIS-6,CIS-9,CIS-12 OCTADECADIENOIC ACID METHYL ESTER
CAS:132029-16-4
Formula: C19H32O2
292.46
ACM132029164
methyl octadeca-6,9,12-trienoate
CIS-6,CIS-9,CIS-12,OCTADECADIENOIC ACID
CAS:1686-12-0
Formula: C18H30O2
278.48
ACM1686120
6,9,12-Octadecatrienoic acid
CIS-6-AMINO-CYCLOHEX-3-ENECARBOXYLIC ACID HYDROCHLORIDE
CAS:57266-56-5
Formula: C7H12ClNO2
177.628680 [g/mol]
ACM57266565
cis-6-Amino-3-cyclohexene-1-carboxylic acid hydrochloride, 57266-56-5, (1S,2R)-(-)-2-Amino-1-cyclohex-4-enecarboxylic acid hydrochloride, ACMC-20aley, ACMC-20apqq, CTK8H5436, 207386-86-5, cis-2-Amino-4-cyclohexene-1-carboxylic acid hydrochloride, (1R,2S)-
CIS-6-NONENAL
CAS:2277-19-2
Formula: C9H16O
140.22
ACM2277192
CIS-6-OCTADECEN-1-OL
CAS:2774-87-0
Formula: C18H36O
268.48
ACM2774870
Petroselinyl alcohol
CIS-6-OCTADECEN-1-OL
CAS:2774-87-0
Formula: C18H36O
268.48
ACM2774870
Petroselinyl alcohol
CIS-6-OCTADECENOIC ACID
CAS:593-39-5
Formula: C18H34O2
282.46
ACM593395
5-Heptadecylene-1-carboxylic acid
CIS-6-OCTADECENOIC ACID ETHYL ESTER
CAS:34302-52-8
Formula: C20H38O2
310.50
ACM34302528
(Z)-6-Octadecenoic acid ethyl ester
CIS-6-OCTADECENOIC ACID METHYL ESTER
CAS:2777-58-4
Formula: C19H36O2
296.49
ACM2777584-1
Petroselinic acid methyl ester
CIS-6-OCTADECENOIC ACID SODIUM SALT
CAS:6697-77-4
Formula: C18H33NaO2
304.44
ACM6697774
Petroselinic acid sodium salt, 6697-77-4
CIS-6-TERT-BUTOXYCARBONYLAMINO-CYCLOHEX-3-ENECARBOXYLIC ACID
CAS:63216-52-4
Formula: C12H19NO4
241.28
ACM63216524
CIS-7,10,13,16,19-DOCOSA-TETRAENOIC ACID METHYL ESTER
CAS:13487-42-8
Formula: C23H38O2
346.55
ACM13487428
CIS-7,10,13,16-DOCOSATETRAENOIC ACID
CAS:28874-58-0
Formula: C22H36O2
332.52
ACM28874580-1
7Z,10Z,13Z,16Z-Docosatetraenoic Acid
CIS-7,10,13,16-DOCOSATETRAENOIC ACID ETHYL ESTER
CAS:142828-41-9
Formula: C24H40O2
360.57
ACM142828419
7Z,10Z,13Z,16Z-Docosatetraenoic Acid ethyl Ester
CIS-7,10,13,16-DOCOSATETRAENOIC ACID METHYL ESTER
CAS:13487-42-8
Formula: C23H38O2
346.55
ACM13487428-1
7Z,10Z,13Z,16Z-Docosatetraenoic Acid Methyl Ester
CIS-7-DODECEN-1-OL
CAS:20056-92-2
Formula: C12H24O
184.32
ACM20056922
(7Z)-7-Dodecen-1-ol;(z)-7-dodecen-1-o;(Z)-7-Dodecen-1-ol;(Z)-7-Dodecenyl alcohol;7-Dodecen-1-ol, (Z)-;Looplure inhibitor;looplureinhibitor;CIS-7-DODECEN-1-OL
CIS-7-DODECEN-1-OL
CAS:20056-92-2
Formula: C12H24O
184.32
ACM20056922
(7Z)-7-Dodecen-1-ol;(z)-7-dodecen-1-o;(Z)-7-Dodecen-1-ol;(Z)-7-Dodecenyl alcohol;7-Dodecen-1-ol, (Z)-;Looplure inhibitor;looplureinhibitor;CIS-7-DODECEN-1-OL
CIS-7-NONADECENOIC ACID
CAS:118020-79-4
Formula: C19H36O2
296.48
ACM118020794
7(Z)-Nonadecenoic acid
CIS-7-NONADECENOIC ACIDETHYL ESTER
Formula: C21H40O2
324.48
ACM-00017792
Ethyl (Z)-7-nonadecenoate
CIS-7-NONADECENOIC ACIDMETHYL ESTER
CAS:146407-37-6
Formula: C20H38O2
310.48
ACM146407376
Methyl 7(Z)-Nonadecenoate
CIS-7-TETRADECENAL
CAS:65128-96-3
Formula: C14H26O
210.36
ACM65128963
7Z-14CHO
CIS-7-TETRADECENAL
CAS:65128-96-3
Formula: C14H26O
210.36
ACM65128963
7Z-14CHO
CIS-8 EICOSENOIC ACID
CAS:76261-96-6
Formula: C20H38O2
310.54
ACM76261966
8Z-Eicosenoic acid
CIS-8,11,14-EICOSATRIENOIC ACID
CAS:1783-84-2
Formula: C20H34O2
306.53
ACM1783842
Homo-?-linolenic acid
CIS-8,11,14-EICOSATRIENOIC ACID
CAS:1783-84-2
Formula: C20H34O2
306.53
ACM1783842
Homo-?-linolenic acid
CIS-8,11,14-EICOSATRIENOIC ACID ETHYL ESTER
CAS:55968-21-3
Formula: C22H38O2
334.50
ACM55968213
Dihomo-?-Linolenic Acid ethyl ester
CIS-8,11,14-EICOSATRIENOIC ACID METHYL ESTER
CAS:21061-10-9
Formula: C21H36O2
320.51
ACM21061109
21061-10-9, AC1LASAW, CTK4E5789, methyl icosa-8,11,14-trienoate, AG-E-54570, Dihomo-.gamma.-Linolenic Acid methyl ester, 8,11,14-Eicosatrienoicacid, methyl ester, (8Z,11Z,14Z)-, 8,11,14-Eicosatrienoicacid, methyl ester, (Z,Z,Z)- (8CI); Dihomo-g-linolenic
CIS-8,11,14-EICOSATRIENOIC ACID METHYL ESTER
CAS:21061-10-9
Formula: C21H36O2
320.51
ACM21061109
21061-10-9, AC1LASAW, CTK4E5789, methyl icosa-8,11,14-trienoate, AG-E-54570, Dihomo-.gamma.-Linolenic Acid methyl ester, 8,11,14-Eicosatrienoicacid, methyl ester, (8Z,11Z,14Z)-, 8,11,14-Eicosatrienoicacid, methyl ester, (Z,Z,Z)- (8CI); Dihomo-g-linolenic
CIS-8-EICOSENOIC ACID ETHYL ESTER
Formula: C22H42O2
338.57
ACM-00017804
8(Z)-Eicosenoic acid ethyl ester
CIS-8-EICOSENOIC ACID METHYL ESTER
CAS:69119-99-9
Formula: C21H40O2
324.54
ACM69119999
8(Z)-Eicosenoic acid Methyl ester
CIS-8-TETRADECEN-1-OLACETATE
CAS:35835-80-4
Formula: C16H30O2
254.40
ACM35835804
Z-8-Tetradecen-1-ol acetate
CIS-8-UNDECEN-1-AL
CAS:147159-49-7
Formula: C11H20O
168.28
ACM147159497
8-Undecenal, cis-8-Undecenal, cis-8-Undecen-1-al, 8-Undecenal, (8Z)-, W526908_ALDRICH, 547220_ALDRICH, MolPort-003-936-413, ZINC05019197, EINECS 261-202-4, CID6436710, 58296-81-4, 147159-49-7
CIS-8-UNDECEN-1-AL
CAS:58296-81-4
Formula: C11H20O
168.28
ACM58296814
cis-8-Undecenal, 8-Undecenal, cis-8-Undecen-1-al, 58296-81-4, ZINC05019197, (Z)-undec-8-enal, AC1O5M8T, W526908_ALDRICH, 547220_ALDRICH, EINECS 261-202-4, ST50824945
CIS-9,CIS-12,CIS-15 OCTADECADIENOIC ACID
CAS:1955-33-5
Formula: C18H30O2
278.48
ACM1955335
Octadeca-9,12,15-trienoic acid
CIS-9,CIS-12,CIS-15 OCTADECADIENOIC ACID ETHYL ESTER
CAS:1191-41-9
Formula: C20H34O2
306.50
ACM1191419
9Z,12Z,15Z-octadecatrienoic acid, ethyl ester
CIS-9,CIS-12,CIS-15 OCTADECADIENOIC ACID METHYL ESTER
CAS:301-00-8
Formula: C19H32O2
292.46
ACM301008-1
Methyl linolenate
CIS-9,CIS-12-OCTADECADIENOIC ACID
CAS:60-33-3
Formula: C18H32O2
280.48
ACM60333
Telfairic acid
CIS-9,CIS-12-OCTADECADIENOIC ACID ETHYL ESTER
CAS:544-35-4
Formula: C20H36O2
308.48
ACM544354
Linoleic acid ethyl ester
CIS-9,CIS-12-OCTADECADIENOIC ACID METHYL ESTER
CAS:112-63-0
Formula: C19H34O2
294.48
ACM112630
Linoleic Acid methyl ester
CIS-9,TRANS-11 OCTADECADIENOIC ACID
CAS:2540-56-9
Formula: C18H32O2
280.48
ACM2540569
9Z,11E-octadecadienoic acid;Bovinic acid
CIS-9,TRANS-11 OCTADECADIENOIC ACID METHYL ESTER
CAS:13058-52-1
Formula: C19H34O2
294.48
ACM13058521
Methyl 9(Z),11(E)-Octadecadienoate
CIS-9-HEXADECENOL
CAS:10378-01-5
Formula: C16H32O
240.42
ACM10378015
Z9-16:OH
CIS-9-OCTADECENE-1-THIOL
CAS:31494-22-1
Formula: C18H36S
284.54344
ACM31494221
cis-9-Octadecene-1-thiol
CIS-9-OCTADECENOIC ACID
CAS:112-80-1
Formula: C18H34O2
282.50
ACM112801
Oleic acid
CIS-9-OCTADECENOIC ACID ETHYL ESTER
CAS:111-62-6
Formula: C20H38O2
310.50
ACM111626
Ethyl Oleate
CIS-9-OCTADECENOIC ACID METHYL ESTER
CAS:112-62-9
Formula: C19H36O2
296.50
ACM112629
Methyl cis-9-Octadecenoate
CIS-9-TETRADECEN-1-OL
CAS:35153-15-2
Formula: C14H28O
212.37
ACM35153152
9-Tetradecen-1-ol, (9z)-
CIS-9-TRICOSENE
CAS:27519-02-4
Formula: C9H16O
322.61
ACM27519024
(Z)-tricos-9-ene; cis-tricos-9-ene; (9Z)-tricos-9-ene; (Z)-Tricos-9-ene; MUSCAMONE; MUSCALURE; Tricosene; tricos-9c-ene; cis-9-Tricosene,Muscalure; FLYBAIT; (9Z)-9-tricosene; cis-9-Tricosene;
CIS-ACONITIC ANHYDRIDE
CAS:6318-55-4
Formula: C6H4O5
156.09
ACM6318554
2,5-dihydro-2,5-dioxo-3-furanaceticaci;CIS-ACONITIC ACID ANHYDRIDE;CIS-ACONITIC ANHYDRIDE;CIS-PROPENE-1,2,3-TRICARBOXYLIC ACID ANHYDRIDE;CIS-PROPENE-1,2,3-TRICARBOXYLIC ANHYDRIDE;2,5-dihydro-2,5-dioxofuran-3-acetic acid;Cis-AconiticAnhydride98%;aconitic a
CIS-BICYCLO[3.1.0]HEXAN-3-OL
CAS:694-43-9
Formula: C6H10O
98.143
ACM694439
CIS-BICYCLO[3.1.0]HEXAN-3-OL;(1R,3r,5S)-Bicyclo[3.1.0]hexan-3-ol
CIS-BIS(ACETONITRILE)DICHLOROPLATINUM(II)
CAS:13869-38-0
Formula: C4H6Cl2N2Pt;
348.09g/mol
ACM13869380
FT-0636973; AC1L9O8A; Dichlorobis(acetonitrile)platinum; Bis(acetonitrile)platinum dichloride; dichloroplatinum; CTK8F8697; SCHEMBL691223;
CIS-BIS(ISOTHIOCYANATO)BIS(2,2'-BIPYRIDYL-4,4'-DICARBOXYLATO)RUTHENIUM (II)
CAS:141460-19-7
Formula: C26H16N6O8RuS2;
705.638g/mol
ACM141460197
141460-19-7;cis-Dithiocyanatobis(N,N'-2,2'-bipyridyl-4,4'-dicarboxylic acid)ruthenium;cis-bis(isothiocyanato)bis(2,2-bipyridyl-4,4-dicarboxylato)-ruthenium(ii);N-3 dye;SCHEMBL789419;460D197;cis-bis(isothiocyanate)bis(2,2'-bipyridyl-4,4'-dicarboxylate)-rut
CIS-CYCLOBUTANE-1,2-DICARBOXYLIC ACID
CAS:1461-94-5
Formula: C6H8O4
144.13
ACM1461945
CIS-DECAHYDRONAPHTHALENE
CAS:493-01-6
Formula: C10H18
138.25
ACM493016
CIS-DECAHYDRONAPHTHALENE
CAS:493-01-6
Formula: C10H18
138.25
ACM493016
CIS-DIAMINEPLATINUM(II) DICHLORIDE
CAS:15663-27-1
Formula: Pt(NH3)2Cl2
300.05
ACM15663271
cis-Dichlorodiammine platinum(II)
CIS-DIAMINEPLATINUM(II) DICHLORIDE
CAS:15663-27-1
Formula: Pt(NH3)2Cl2
300.05
ACM15663271
cis-Dichlorodiammine platinum(II)
CIS-DIAMMINE-DIIODO PLATINUM II
CAS:13841-96-8
Formula: H6I2N2Pt
482.95
ACM13841968
Diamminediiodo-platinum; Diamminediiodoplatinum;
CIS-DIAMMINEDIIODOPLATINUM
CAS:15978-93-5
Formula: H6I2N2Pt;
482.955g/mol
ACM15978935
ST24046346; cis-Diiododiammineplatinum(II); X6027; I14-42024; diaminediiodoplatinum(ii); 15978-93-5;
CIS-DIBROMOBIS(TRIPHENYLPHOSPHITE)PLATINUM(II)
CAS:41871-81-2
Formula: PtBr2(P(OPh)3)2
975.5
ACM41871812
CIS-DIBROMOBIS(TRIPHENYLPHOSPHITE)PLATINUM(II)
CAS:41871-81-2
Formula: PtBr2(P(OPh)3)2
975.5
ACM41871812
CIS-DICHLOROBIS(2,2'-BIPYRIDINE)-RUTHENIUM(II)DIHYDRATE
CAS:15746-57-3
Formula: C20H16Cl2N4Ru2H2O
520.38
ACM15746573
cis-Bis(2,2'-bipyridine)dichlororuthenium(II) dihydrate
CIS-DICHLOROBIS(2,2'-BIPYRIDINE)-RUTHENIUM(II)DIHYDRATE
CAS:15746-57-3
Formula: C20H16Cl2N4Ru2H2O
520.38
ACM15746573
cis-Bis(2,2'-bipyridine)dichlororuthenium(II) dihydrate
CIS-DICHLOROBIS(2,2'-BIPYRIDINE)RUTHENIUM(II)
CAS:98014-14-3
Formula: C20H18Cl2N4ORu;
502.361g/mol
ACM98014143
cis-Bis(2,2'-bipyridine)dichlororuthenium(II) hydrate, 97%; cis-Bis(2,2-bipyridine)dichlororuthenium(ii)hydrate; cis-Bis(2,2 inverted exclamation marka-bipyridine)dichlororuthenium(II) hydrate; cis-Dichlorobis(2,2'-bipyridine)ruthenium(II), 97%; VP14897;
CIS-DICHLOROBIS(DIETHYL SULFIDE)PLATINUM(II)
CAS:15442-57-6
Formula: C8H20Cl2PtS2;
446.352g/mol
ACM15442576
Platinum, dichlorobis(1,1'-thiobis(ethane))-; ethylsulfanylethane; C8H20Cl2PtS2; 15442-57-6; trans-Dichlorobis(diethylsulfide)platinum(II); cis-Dichlorobis(diethylsulfide)platinum(II); 15337-84-5; CTK6G5001; Dichlorobis(1,1'-thiobis(ethane))platinum; tran
CIS-DICHLOROBIS(DIMETHYL SULFOXIDE)PLATINUM(II)
CAS:22840-91-1
422.25
ACM22840911
CIS-DICHLOROBIS(PYRIDINE)PLATINUM(II)
CAS:14872-21-0
Formula: C10H10Cl2N2Pt
424.19
ACM14872210
cis-Bis(pyridine)platinum(II)chloride
CIS-DICHLOROBIS(PYRIDINE)PLATINUM(II)
CAS:15227-42-6
Formula: C10H10Cl2N2Pt12*
424.18
ACM15227426
cis-Dichlorobis(pyridine)platinum(II); AC1LAZ0B; J-008909; DICHLOROBIS(PYRIDINE) PLATINUM (II); SC10694; AC1N5AVR; platinum(II) chloride; SCHEMBL1308971; 14872-21-0; FT-0696290;
CIS-DICHLOROBIS(TRIETHYLPHOSPHINE)PLATINUM(II)
CAS:15692-07-6
Formula: C12H30Cl2P2Pt;
502.304g/mol
ACM15692076
AKOS015911327; cis-Dichlorobis(triethylphosphine)platinum(II), 98%; SC10689; (Et3P)2PtCl2; FT-0722859; 13965-02-1; Platinum,dichlorobis(triethylphosphine)-,(sp-4-1)-(9ci); cis-dichlorobis (triethylphosphine)platinum (ii); I14-38485; cis-Bis(triethylphosph
CIS-DICHLOROBIS(TRIPHENYLPHOSPHINE)PLATINUM(II)
CAS:10199-34-5
Formula: Pt[(C6H5)3P]2Cl2
790.57
ACM10199345
Dichlorobis(triphenylphosphine)platinum
CIS-DICHLOROBIS(TRIPHENYLPHOSPHINE)PLATINUM(II)
CAS:10199-34-5
Formula: Pt[(C6H5)3P]2Cl2
790.57
ACM10199345
Dichlorobis(triphenylphosphine)platinum
CIS-DICHLOROBIS(TRIPHENYLPHOSPHINE)PLATINUM(II)
CAS:15604-36-1
Formula: C36H30Cl2P2Pt;
790.568g/mol
ACM15604361
PLATINUM, DICHLOROBIS(TRIPHENYLPHOSPHINE)-, (SP-4-2)-; cis-Bis(triphenylphosphine)platinum(II) dichloride; AC1O0U3P; FT-0658376; cis-Bis(triphenylphosphine)platinum(II) chloride; DICHLOROBIS(TRIPHENYLPHOSPHINE)PLATIN UM; AN-10893; MFCD00010825; 14056-88-3
CIS-DICHLOROBIS(TRIPHENYLPHOSPHITE)PLATINUM(II)
CAS:30053-58-8
Formula: Pt[P(OC6H5)3]2Cl2
886.55
ACM30053588
DICHLOROBIS(TRIPHENYLPHOSPHINE)PLATINATE (II);CIS-DICHLOROBIS(TRIPHENYLPHOSPHITE)PLATINUM(II);CIS PTCL2(PPH3)2;CIS-BIS(TRIPHENYLPHOSPHINE)PLATINUM(II) DICHLORIDE;TRANS-DICHLOROBIS(TRIPHENYLPHOSPHINE)PLATINUM(II)
CIS-DICHLOROBIS(TRIPHENYLPHOSPHITE)PLATINUM(II)
CAS:30053-58-8
Formula: Pt[P(OC6H5)3]2Cl2
886.55
ACM30053588
DICHLOROBIS(TRIPHENYLPHOSPHINE)PLATINATE (II);CIS-DICHLOROBIS(TRIPHENYLPHOSPHITE)PLATINUM(II);CIS PTCL2(PPH3)2;CIS-BIS(TRIPHENYLPHOSPHINE)PLATINUM(II) DICHLORIDE;TRANS-DICHLOROBIS(TRIPHENYLPHOSPHINE)PLATINUM(II)
CIS-DL-3-(2,2-DICHLOROVINYL)-2,2-DIMETHYLCYCLOPROPANECARBOXYLIC ACID
CAS:59042-49-8
Formula: C8H10Cl2O2
209.0698
ACM59042498
cis-Cypermethric acid;cis-3-(2,2-Dichlorovinyl)-2,2-dimethyl cyclopropane-1-carboxylic acid
CIS-ENDO-BICYCLO(2.2.1)HEPTANE-2,3-DICARBOXYLICACID,DISODIUMSALT
CAS:351870-33-2
0
ACM351870332
CIS-ENDO-BICYCLO(2.2.1)HEPTANE-2,3-DICARBOXYLICACID,DISODIUMSALT;(1R,2R,3S,4S)-rel-Bicyclo[2.2.1]heptane-2,3-dicarboxylic acid, disodium salt
CIS-EPOXYSUCCINIC ACID
CAS:16533-72-5
Formula: C4H4O5
132.07
ACM16533725
CIS-HEPTACHLOREPOXIDE EXO-,ISOMER B
CAS:1024-57-3
Formula: C10H5Cl7O
389.32
ACM1024573
CIS-INOSITOL
CAS:576-63-6
Formula: C6H12O6
180.16
ACM576636
CIS-JASMONE
CAS:488-10-8
Formula: C11H16O
164.25
ACM488108
CIS-MEVINPHOS PESTANAL 50 MG
CAS:298-01-1
Formula: C7H13O6P
224.148
ACM298011
CIS-N-BOC-1,3-DIAMINOCYCLOBUTANE
CAS:1212395-34-0
Formula: C9H18N2O2
186.26
ACM1212395340
CIS-NEROLIDOL
CAS:3790-78-1
Formula: C15H26O
222.37
ACM3790781-1
(6Z)-3,7,11-Trimethyl-1,6,10-dodecatrien-3-ol; (Z)-Nerolidol; ()-cis-Nerolidol; cis-Nerolidol
CIS-O-METHYL-O-COUMARIC ACID
CAS:14737-91-8
Formula: C10H10O3
178.18
ACM14737918
Substance H 36, cis-2-Methoxycinnamic acid, cis-o-Methoxycinnamic acid, o-Methoxycinnamic acid, (Z)-o-Methoxycinnamic acid, Spectrum5_000144, BSPBio_001674, SPECTRUM210568, 250554_ALDRICH, EINECS 238-803-5, Acide ortho-methoxycinnamique [French], BRN 2209
CIS-OCTAHYDRO-1H-ISOINDOL-1-ONE
CAS:10479-68-2
Formula: C8H13NO
139.19492
ACM10479682
cis-octahydro-1H-isoindol-1-one;(3aR,7aS)-rel-octahydro-1H-Isoindol-1-one (Relative struc)
CIS-PERMETHRIN
CAS:61949-76-6
Formula: C21H20Cl2O3
391.29
ACM61949766
CIS-PICEATANNOL
CAS:106325-86-4
Formula: C14H12O4
244.24268
ACM106325864
cis-Piceatannol;(Z)-4-[2-(3,5-Dihydroxyphenyl)ethenyl]-1,2-benzenediol
CIS-STILBENE OXIDE
CAS:1689-71-0
Formula: C14H12O
196.24
ACM1689710
Oxirane, 2,3-diphenyl-, cis-;Oxirane,cis-2,3-diphenyl-;CIS-STILBENE OXIDE;cis-2,3-diphenyloxirane;(2R,3S)-2,3-Diphenyloxirane;(2S,3R)-2,3-Diphenyloxirane;meso-Stilbene oxide;Bibenzyl, .alpha.,.alpha.-epoxy-, cis-
CIS-STYRENE-(SS)-D
CAS:21370-59-2
Formula: C8H7D
105.16
ACM21370592
CIS-STYRENE-ALPHA,BETA-D2
CAS:60052-92-8
Formula: C8D2H6
106.16
ACM60052928
(1,2-dideuterio-vinyl)-benzene; a,-Dideuterio-styrol; (a,-D2)-Styrol; Dideuterostyren;
CIS-TETRACHLORODIAMMINE PLATINUM(IV)
CAS:16893-06-4
Formula: Cl4H6N2Pt
370.95
ACM16893064
CIS-TETRACHLORODIAMMINE PLATINUM (IV);CIS-DIAMMINETETRACHLOROPLATINUM(IV);DIAMMINETETRACHLOROPLATINATE (IV);TRANS-TETRACHLORODIAMMINE PLATINUM (IV);TRANS-DIAMMINETETRACHLOROPLATINUM(IV);(e)-platinum(iv;(oc-6-11)-platinu;trans-bisamminetetrachloroplatinum
CIS-TETRACHLORODIAMMINE PLATINUM(IV)
CAS:16893-06-4
Formula: Cl4H6N2Pt
370.95
ACM16893064
CIS-TETRACHLORODIAMMINE PLATINUM (IV);CIS-DIAMMINETETRACHLOROPLATINUM(IV);DIAMMINETETRACHLOROPLATINATE (IV);TRANS-TETRACHLORODIAMMINE PLATINUM (IV);TRANS-DIAMMINETETRACHLOROPLATINUM(IV);(e)-platinum(iv;(oc-6-11)-platinu;trans-bisamminetetrachloroplatinum
CIS-TETRACHLORODIAMMINE PLATINUM(IV)
CAS:16893-05-3
Formula: Cl4H6N2Pt
370.95
ACM16893053
TRANS-DIAMMINETETRACHLOROPLATINUM(IV);TRANS-TETRACHLORODIAMMINE PLATINUM (IV);(oc-6-22)-platinu;(z)-platinum(iv;cis-diamminotetrachloroplatinum;cis-platinum(iv)diamminotetrachloride;cis-platinumdiamminetetrachloride;nsc119876
CIS-TRANS-FARNESOL
CAS:3790-71-4
Formula: C15H26O
0
ACM3790714
CIS-TRANS-FARNESOL;2,6,10-Dodecatrien-1-ol,3,;cis-Farnesol;(2Z,6E)-3,7,11-Trimethyl-2,6,10-dodecatrien-1-ol;(2Z,6E)-Farnesol;(Z,E)-Farnesol;(Z,E)-3,7,11-Trimethyl-2,6,10-dodecatrien-1-ol;2-cis,6-trans-Farnesol
CIS-TRI->N-BUTYL(1-PROPENYL)TIN
CAS:66680-84-0
Formula: C15H32Sn
331.12
ACM66680840
ghl.PD_Mitscher_leg0.1273, (Z)-Tri-n-butyl(1-propenyl)tin, CID10914524, TC-069405, 66680-84-0
CIS-UROCANIC ACID
CAS:7699-35-6
Formula: C6H6N2O2
138.12
ACM7699356
3-[1H-imidazol-4(5)-yl]; Cis-Urocanic Acid-[13C3]; (E)-3-(3H-imidazol-4-yl)prop-2-enoic acid; (Z)-Urocanic acid; cis-Urocanic acid; (Z)-2-propenoic acid; (Z)-3-(1H-imidazol-4-yl)-2-propenoic acid; (2Z)-3-(1H-Imidazole-4-yl)acrylic acid; (Z)-3-(1H-Imidazol
CIS-VACCENOYL CHLORIDE
CAS:95548-26-8
Formula: C18H33ClO
300.91
ACM95548268
cis-Vaccenoyl chloride, Octadec-11-enoyl Chloride, CID4245417, 95548-26-8
CISPLATIN DINITRODIAMMINEPLATINUM
CAS:14286-02-03
Formula: Pt(NH3)2(NO2)2
321.23
ACM142860203
CISTUS LADANIFERUS
CAS:89997-74-0
ACM89997740
CITALOPRAM HYDROCHLORIDE
CAS:85118-27-0
Formula: C20H21FN2OHCl
360.86
ACM85118270
Citalopram hydrochloride;1-[3-(Dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile hydrochloride
CITCO
CAS:338404-52-7
Formula: C19H12N3OCl3S
436.74
ACM338404527
CITENAMIDE
CAS:10423-37-7
ACM10423377
CITRACONIC ACID
CAS:498-23-7
Formula: C5H6O4
130.1
ACM498237
CITRACONIC ANHYDRIDE
CAS:616-02-4
Formula: C5H4O3
112.08
ACM616024
3-Methyl-2,5-pentanedione
CITRACONIC ANHYDRIDE
CAS:616-02-4
Formula: C5H4O3
112.08
ACM616024
3-Methyl-2,5-pentanedione
CITRAL
CAS:5392-40-5
Formula: C10H16O
152.23
ACM5392405
3,7-Dimethyl-2,6-octadienal
CITRAMALIC ACIDSODIUMSALT
CAS:102601-31-0
Formula: C5H6Na2O5
192.077679;g/mol
ACM102601310
DL-2-METHYLMALIC ACID; PLUS-MINUS-CITRAMALIC ACID SODIUMCRYSTAL LINE;
CITRATE MODIFIED FE3O4 MICROSPHERES(D: 200 NM)
CAS:12227-89-3
ACM12227893-2
CITRATE MODIFIED FE3O4 MICROSPHERES(D: 300 NM)
CAS:12227-89-3
ACM12227893-4
CITRATE MODIFIED FE3O4 MICROSPHERES(D: 500 NM)
CAS:12227-89-3
ACM12227893-1
CITRATE SYNTHASE
CAS:9027-96-7
Formula: C6H5O7-3
189.0997
ACM9027967
CITRIC ACID
CAS:77-92-9
Formula: C6H8O7
192.12
ACM77929
1,2,3-Tricarboxy-2-hydroxypropane;2-hydroxypropanetricarboxylicacid;acidecitrique;Aciletten;Anhydrous citric acid;anhydrouscitricacid;beta-Hydroxytricarballylic acid;beta-hydroxytricarballylicacid
CITRIC ACID ANHYDRIDE ACETATE
CAS:58032-65-8
Formula: C8H8O7
216.14
ACM58032658
CITRIC ACID ANHYDRIDE ACETATE
CITRIC ACID MONOSTEARYL ESTER
CAS:1337-33-3
Formula: C24H43O7
458.59
ACM1337333
Citric acid monostearyl ester;Stearyl citrate
CITRIC ACID,LEAD SALT
CAS:14450-60-3
Formula: C12H10O14Pb3
999.799400 [g/mol]
ACM14450603
citric acid , lead (II)-hydrogencitrate; Citronensaeure, Blei(II)-hydrogencitrate; LEAD CITRATE;
CITRIC-1,5-13C2 ACID,99 ATOM % 13C
CAS:302912-06-7
Formula: 13C2C4H8O7
194.11
ACM302912067
Citric acid-1,5-13C2, 302912-06-7
CITRIC-2,2,4,4-D4 ACID
CAS:147664-83-3
Formula: C6H4D4O7
196.15
ACM147664833
Citro-d4; Aciletten-d4; Citric acid-2,2,4,4-d4; Citretten-d4; Chemfill-d4; Celenex 3P6-d4;
CITRONELLYL SENECIOATE
CAS:20770-40-5
Formula: C15H26O2
238.3657
ACM20770405
2-butenoicacid,3-methyl-,3,7-dimethyl-6-octenylester;SINODOR;CITRONELLYL-SENECIOATE;CITRONELLYL-3-METHYLBUT-2-ENOATE;citronellyl 3-methylcrotonate;CITRONELLYL METHYLCROTONATE;citronellyl seneciate;Citronellyl-3-methylcrotonat
CITRONELLYL TIGLATE, MIXTURE OF ISOMERS
CAS:255714-11-5
238.37
ACM255714115
CITRONELLYL VALERATE
CAS:7540-53-6
Formula: C15H28O2
240.38
ACM7540536
CITRULLINE MALATE
CAS:54940-97-5
Formula: C10H19N3O8
309.273
ACM54940975
Citrulline malate;L-Citrulline DL-malate (1:1);L-Citrulline DL-malate (2:1)
CITRUS RETICULATA BLANCO.
ACM-00003429
CIVENTICHEM CV-4057
CAS:248281-84-7
Formula: C19H17ClN2O3
356.807
ACM248281847
CIVENTICHEM CV-4057;LAQUINIMOD,5-CHLORO-4-HYDROXY-1-METHYL-2-OXO-1,2-DIHYDRO-QUINOLINE-3-CARBOXYLIC ACID ETHYL-PHENYL-AMIDE;5-Chloro-4-hydroxy-1-methyl-2-oxo-N-ethyl-N-phenyl-1,2-dihydroquinoline-3-carboxamide;Lanquinimod;LaquiniMod,CiventicheMCV-4057,5-C
CIVETONE
CAS:542-46-1
Formula: C17H30O
250.42
ACM542461
(Z)-9-Cycloheptadecen-1-one
CJ 033466
CAS:519148-48-2
Formula: C19H28ClN5O
C19H28ClN5O
ACM519148482
CJC1295
CAS:863288-34-0
Formula: C159H258N46O45
0
ACM863288340
CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-
CK-548
CAS:388604-55-5
Formula: C15H11BrClNO2S
384.68
ACM388604555
AC1N9E0V, MolPort-010-781-134, CK-548, CCG-198484, MCULE-9421572056, CK-0993548, 2-(3-Bromophenyl)-3-(5-chloro-2-hydroxyphenyl)-4-thiazolidinone, 2-(3-bromophenyl)-3-(5-chloro-2-hydroxyphenyl)-1,3-thiazolidin-4-one, 388604-55-5
CK-869
CAS:388592-44-7
Formula: C17H16BrNO3S
394.28
ACM388592447
AC1MTEVB, ChemDivAM_000348, ChemDiv1_012738, CHEMBL3261538, HMS623C22, MolPort-010-976-877, CCG-33400, CK 869, AKOS002089815, AKOS021653521, MCULE-8232235221, CK-0157869, EU-0093645, 2-(3-Bromophenyl)-3-(2,4-dimethoxyphenyl)-4-thiazolidinone, 2-(3-bromoph
CK2 INHIBITOR II
CAS:749234-11-5
Formula: C9H7Br4N3
476.791
ACM749234115
4,5,6,7-tetrabroMo-N,N-diMethyl-1H-benzo[d]iMidazol-2-aMine;2-Dimethylamino-4,5,6,7-tetrabromobenzimidazole
CKI-7 DIHYDROCHLORIDE
CAS:1177141-67-1
Formula: C11H12ClN3O2S.2HCl
358.67
ACM1177141671
1177141-67-1
CLARITHROMYCIN
CAS:81103-11-9
Formula: C38H69NO13
747.95
ACM81103119-1
6-o-methyl-erythromyci;6-o-methylerythromycina;clathromycin;te-03;TE-031;6-O-METHYLERYTHROMYCIN;6-(4-DIMETHYLAMINO-3-HYDROXY-6-METHYL-OXAN-2-YL)OXY-14-ETHYL-12,13-DIHYDROXY-4-(5-HYDROXY-4-METHOXY-4,6-DIMETHYL-OXAN-2-YL)OXY-7-METHOXY-3,5,7,9,11,13-HEXAMETH
CLARITHROMYCIN RELATED CO
CAS:81103-14-2
ACM81103142
CLASTO-LACTACYSTIN BETA-LACTONE
CAS:154226-60-5
Formula: C10H15NO4
213.23
ACM154226605
clasto-Lactacystin |A-lactone, 154226-60-5
CLAVULANIC ACID DIMER IMPURITY
CAS:1260617-10-4
Formula: C16H18N2O10
398.32152
ACM1260617104
Clavulanic Acid DiMer IMpurity;(2R,4R,5Z)-4-Carboxy-5-(2-hydroxyethylidene)-3-[[(2R,3Z,5R)-3-(2-hydroxyethylidene)-7-oxo-4-oxa-1-azabicyclo[3.2.0]hept-2-yl]carbonyl]-2-oxazolidineacetic Acid;PotassiuM Clavunate IMpurity E
CLEMIZOLE HYDROCHLORIDE
CAS:1163-36-6
Formula: C19H21Cl2N3
362.3
ACM1163366
1-(p-chlorobenzil)-2-pirrolidil-metil-benzimidazolocloridato;1-(p-chlorobenzyl)-2-(1-pyrrolidinylmethyl)-benzimidazolmonohydrochloride;1-p-chlorobenzyl-pyrrolidyl-methylene-benzimidazolehydrochloride;allercur;allercurehydrochloride;p48;1-P-CHLOROBENZYL-2-
CLEMIZOLE PENICILLIN
CAS:6011-39-8
Formula: C19H20ClN3.C16H18N2O4S
660.235
ACM6011398
Clemizole penicillin;Benzylpenicillin clemizole
CLENBUTEROL HYDROCHLORIDE
CAS:21898-19-1
Formula: C12H19Cl3N2O
313.65
ACM21898191
NAB 365CL;4-amino-alpha-((tert-butylamino)methyl)-3,5-dichlorobenzylalcoholhydrochlor;4-amino-alpha-((tert-butylamino)methyl)-3,5-dichloro-benzylalcohomonohydr;4-amino-alpha-((tert-butylamino)methyl)-3,5-dichlorobenzylalkohol-hydrochlor;clenbuterolclorhid
CLENBUTEROL HYDROCHLORIDE
CAS:21898-19-1
Formula: C12H19Cl3N2O
313.65
ACM21898191
NAB 365CL;4-amino-alpha-((tert-butylamino)methyl)-3,5-dichlorobenzylalcoholhydrochlor;4-amino-alpha-((tert-butylamino)methyl)-3,5-dichloro-benzylalcohomonohydr;4-amino-alpha-((tert-butylamino)methyl)-3,5-dichlorobenzylalkohol-hydrochlor;clenbuterolclorhid
CLIMBAZOLE
CAS:38083-17-9
Formula: C15H17ClN2O2
292.76
ACM38083179
1-(4-Chlorophenoxy)-1-(imidazol-1-yl)-3,3-dimethyl-2-butanone
CLIMBAZOLE
CAS:38083-17-9
Formula: C15H17ClN2O2
292.76
ACM38083179
1-(4-Chlorophenoxy)-1-(imidazol-1-yl)-3,3-dimethyl-2-butanone
CLINDAMYCIN
CAS:18323-44-9
Formula: C18H33ClN2O5S
424.98
ACM18323449
CLINDAMYCIN;-1-thio-trans-alpha-l-threo-d-galacto-octopyranoside;7-cdl;7-chloro-7-deoxylincomycin;7-chlorodeoxylincomycin;7-chlorolincomycin;7-deoxy-7(s)-chlorolincomycin;chlolincocin
CLINDAMYCIN 3-PHOSPHATEDISCONTINUED
CAS:28708-34-1
Formula: C18H34ClN2O8PS
504.96
ACM28708341
(2S-trans)-
CLINDAMYCIN B 2-PHOSPHATE
CAS:54887-31-9
Formula: C17H32ClN2O8PS
490.94
ACM54887319
Methyl 7-Chloro-6,7,8-trideoxy-6-[[[(2S,4R)-4-ethyl-1-methyl-2-pyrrolidinyl]
carbonyl]amino]-1-thio-L-threo-a-D-galactooctopyranoside 2-(Dihydrogen Phosphate); (2S-trans)-
CLOBETASOL 17-PROPIONATE
CAS:25122-41-2
Formula: C25H32ClFO5
466.97
ACM25122412
(11b,16b)-21-Chloro-9-fluoro-11-hydroxy-16-methyl-17-(1-oxopropoxy)pregna-1,4-diene-3,20-dione
CLOBETASOL PROPIONATE
CAS:25122-46-7
Formula: C25H32ClFO5
466.97
ACM25122467
Olux; cgp9555; GR-2/92; CCl 4725; 21-Chloro-9a-fluoro-11,17a-dihydroxy-16-methyl-1,4-pregnadiene-3,20-dione 17-Propionate; Clobetasol propionate; clobetasol-17-propionate; Dermoval; Psorex; Clobetasol 17-Propionate; GR 2/925; clobesol; Dermovate; Closo
CLOBETASONE
CAS:54063-32-0
Formula: C22H26ClFO4
308.91
ACM54063320
EINECS 258-953-5; Clobetasona; Clobetasone; UNII-LT69WY1J6D; Clobetasonum;
CLODRONIC ACID
CAS:10596-23-3
Formula: CH4Cl2O6P2
244.89
ACM10596233
CLODRONIC ACID;Disodium diphosphonate;Clodronic;(Dichloromethylene)bis(phosphonic acid);ARC-69931;Dichloromethylenebis(phosphonic acid);Dichloromethylenebisphosphonic acid;Aids071014
CLODRONIC ACID
CAS:10596-23-3
Formula: CH4Cl2O6P2
244.89
ACM10596233
CLODRONIC ACID;Disodium diphosphonate;Clodronic;(Dichloromethylene)bis(phosphonic acid);ARC-69931;Dichloromethylenebis(phosphonic acid);Dichloromethylenebisphosphonic acid;Aids071014
CLOFAZIMINE
CAS:2030-63-9
Formula: C27H22CL2N4
473.4
ACM2030639
2-phenazinamine,3,5-dihydro-n,5-bis(4-chlorophenyl)-3-((1-methylethyl)imino);3-(p-chloranilino)-10-(p-chlorphenyl)-2,10-dihydro-2-(isopropylimino)-phenaz;b-663;b663(pharmaceutical);chlofazimine;g30320;lampren;nsc-141046
CLOFILIUM TOSYLATE
CAS:92953-10-1
Formula: C28H44ClNO3S
510.17
ACM92953101
CLOFLUBICYNE
CAS:224790-70-9
Formula: C11H6Cl2F6N2
351.08
ACM224790709
Cloflubicyne
CLOMAZONE
CAS:81777-89-1
Formula: C12H14ClNO2
239.70
ACM81777891
CLOMIFENE
CAS:911-45-5
Formula: C26H29Cl2NO
442.42
ACM911455
E/Z-CloMiphene-d4; Clomiphene,E/Z-mixture; Clomiphene; Clomifene; Clomiphene B;
CLOMIPHENE CITRATE
CAS:50-41-9
Formula: C32H36ClNO8
598.08
ACM50419
Clomiphene (citrate); clomiphen citrate; Clomifene citrate; fertyl; mrl41; omifin; CLOMID; dyneric; mer41; clomivid; genozym; 2-(4-[2-Chloro-1,2-diphenylethenyl]phenoxy)-N,N-diethylethanamine,Clomiphene citrate salt; CLOMPHID; 2-(4-(2-chloro-1,2-diphenyle
CLOMIPHENE RELATED COMP
CAS:74056-26-1
Formula: C26H30ClNO
407.975500 [g/mol]
ACM74056261
EINECS 277-686-5, 2-(4-(1,2-Diphenylvinyl)phenoxy)ethyl(diethyl)ammonium chloride, 74056-26-1
CLONIDINE(200 MG)
CAS:4205-90-7
Formula: C9H10Cl3N3
266.5548
ACM4205907
CLONIDINE BASE;Clonidine (base and/or unspecified salts);CLONIDINE (200 MG);1H-Imidazol-2-amine, N-(2,6-dichlorophenyl)-4,5-dihydro-;2-((2,6-dichlorophenyl)amino)-2-imidazoline;2-(2,6-dichloroanilino)-1,3-diazacyclopentene-(2);2-(2,6-dichloroanilino)-2-im
CLOPERASTINE HYDROCHLORIDE
CAS:14984-68-0
Formula: C20H24ClNO?HCl;C20H25Cl2NO
366.33
ACM14984680
CLORGYLINE
CAS:17780-72-2
Formula: C13H15Cl2NO
272.1703
ACM17780722
CLORGYLINE HYDROCHLORIDE
CAS:17780-75-5
Formula: C13H16Cl3NO
308.63
ACM17780755
CLORICROMENE
CAS:74697-28-2
Formula: C20H26ClNO5??HCl
432.34
ACM74697282
Cloricromen hydrochloride, DSSTox_CID_26499, DSSTox_RID_81668, DSSTox_GSID_46499, 8-Chloro-3-(2-diethylaminoethyl)-7-ethoxycarbonylmethoxy-4-methylcoumarin hydrochloride, CAS-74697-28-2, NCGC00165769-02, AD6, Proendotel (TN), Cloricromen hydrohloride, C46
CLOROBIOCIN
CAS:39868-96-7
ACM39868967
CLOTHIANIDIN
CAS:210880-92-5
Formula: C6H8ClN5O2S
249.68
ACM210880925
CLOTHIANIDIN;Clothianidin PESTANAL;Guanidine, N-(2-chloro-5-thiazolyl)methyl-N-methyl-N-nitro-, C(E)-;clothianidine;3-[(2-chloro-1,3-thiazol-5-yl)methyl]-2-methyl-1-nitro-guanidine;CLOTHIANIDIN STANDARD;(E)-1-(2-Chloro-1,3-thiazol-5-ylmethyl)-3-methyl-2-n
CLOTIXAMIDE
CAS:4177-58-6
Formula: C24H28ClN3OS
442.02
ACM4177586
Clothixamid, Clotixamida, Clotixamide, Clotixamidum, UNII-24623E6DZD, CID5887853, 3-(4-(3-(2-Chlorthioxanthen-9-yliden)propyl)-1-piperazinyl)-N-methylpropionamid, 3-[4-[3-(2-chlorothioxanthen-9-ylidene)propyl]piperazin-1-yl]-N-methyl-propanamide, 4-(3-(2-
CLOZAPINE N-OXIDE
CAS:34233-69-7
Formula: C18H19ClN4O
342.82
ACM34233697
e)(1,4)diazepine,8-chloro-11-(4-methyl-1-piperazinyl)-5h-dibenzo(n-oxide;CLOZAPINE N-OXIDE;8-CHLORO-11-[4-METHYL-1-PIPERAZINYL]-5H-DIBENZO[B,E][1,4]DIAZEPINE N-OXIDE;Clozapine N-oxide solution;Clozapine N-oxide Methanol Adduct
CM SEPHAROSE
CAS:102899-98-9
ACM102899989
CM SEPHAROSE;CM SEPHAROSE FAST FLOW;CM SEPHAROSE CATION EXCHANGER FAST FLOW;Sepharose CCF
CM-SEPHAROSE(R) CL-6B, FOR CHROMATO- GRAPHY*
CAS:68894-07-5
ACM68894075
CMBH
CAS:100011-37-8
ACM100011378
CMDA
CAS:122665-73-0
Formula: C17H23ClN2O8S
450.89
ACM122665730
CMK-3
CAS:7440-44-0
ACM7440440-216
CMK-8
CAS:7440-44-0
ACM7440440-161
CMPF
CAS:86879-39-2
Formula: C12H16O5
240.25
ACM86879392
CMPF;3-carboxy-4-methyl-5-propyl-2-furanpropionic acid;3-[(3-Carboxy-4-methyl-5-propylfuran)-2-yl]propionic acid;3-Carboxy-4-methyl-5-propylfuran 2-propanoic acid;Furanic acid;Propylfuranoic acid;CMPF, 3-carboxy-4-methyl-5-propyl-2-furanpropionic acid
CNICIN
CAS:24394-09-0
Formula: C20H26O7
378.42
ACM24394090
cnicine;-lactone,8-(3,4-dihydroxy-2-methylenebutyrate);CYNISIN;CNICIN;CENTAURIN;2,3,3a,4,5,8,9,11a-octahydro-10-(hydroxymethyl)-6-methyl-3-methylene-2-oxocyclodeca[b]furan-4-yl 3,4-dihydroxy-2-methylenebutyrate;(3R)-3,4-Dihydroxy-2-methylenebutyric acid (
CO 101244 HYDROCHLORIDE
CAS:193359-26-1
Formula: C21H27NO3.HCl
377.90492
ACM193359261
Co 101244 hydrochloride, 193359-26-1, 1-[2-(4-HYDROXYPHENOXY)ETHYL]-4-[(4-METHYLPHENYL)METHYL]-4-PIPERIDINOL MONOHYDROCHLORIDE, Co-101244, PD-174494, AC1OCFF0, SureCN1994218, CTK8E7402, MB06546, KB-216981, 1-[2-(4-hydroxyphenoxy)ethyl]-4-[(4-methylphenyl)
CO(II)(BPY)3(TFSI)2
CAS:1353745-90-0
ACM1353745900
CO(II)(BPY-PZ)2(PF6)2
CAS:312322-08-0
ACM312322080
CO(II)(PHEN)3(PF6)2
CAS:31876-74-1
ACM31876741
CO(III)(BPY)3(TFSI)3
CAS:1353745-91-1
ACM1353745911
CO(III)(BPY-PZ)2(PF6)3
CAS:1346417-60-4
ACM1346417604
CO(III)(PHEN)3(PF6)3
CAS:28277-59-0
ACM28277590
COAGULATION FACTOR VIIA, HUMAN
CAS:102786-61-8
ACM102786618
RECOMBINANT HUMAN FACTOR VIIA;NATIVE HUMAN FACTOR VIIA;FACTOR VIIA;FACTOR VIIA, HUMAN;COAGULATION FACTOR VIIA;COAGULATION FACTOR VIIA, HUMAN;COAGULATION FACTOR VIIA, HUMAN PLASMA;EC: 3.4.21.2
COALTAR
CAS:8055-92-3
ACM8055923
COBALT
CAS:7440-48-4
Formula: Co;
58.933g/mol
ACM7440484-6
Cobalt, lump, 40 mm max. lump size, weight 2000 g, purity 99.8%; Cobalt Yeast 18 mcg/gm; Cobalt, foil, 10mm disks, thickness 0.025mm, 99.9%; Cobalt, rod, 3.0 mm diameter, length 200 mm, purity 99.9%; Cobalt, foil, 100x100mm, thickness 2.0mm, as rolled, 99
COBALT ACETATE
CAS:71-48-7
Formula: C4H6CoO4
177.02
ACM71487
COBALT(II) ACETATE;COBALT ACETATE;acetatecobalteux;Aceticacid,cobalt(2+)salt;aceticacid,cobalt(2++)salt;bis(acetato)cobalt;cobalt(2+)acetate;cobaltacetate(co(oac)2)
COBALT ALUMINUM OXIDE
CAS:12672-27-4
Formula: CoAl2O4
251.826476
ACM12672274
COBALT ALUMINUM OXIDE NANOPARTICLES / NANOPOWDER
CAS:1333-88-6
Formula: Al2CoO4
176.89
ACM1333886
Cobalt(II) Aluminate
COBALT AMMONIUM PHOSPHATE
CAS:16827-96-6
Formula: H6NO5PCo
189.96
ACM16827966
COBALT BIS(2-ETHYLHEXANOATE)
CAS:136-52-7
Formula: C16H30CoO4
345.34
ACM136527
Cobalt(II)bis(2-ethylhexanoate)
COBALT BLUE
CAS:1345-16-0
Formula: CoOAl2O3
ACM1345160
C.I.Pigmentblue28;Cobaltaluminatebluespinel;FERRISPEC(R) PL COBALT BLUE;COBALT BLUE;CI 77346;Cobaltbluetech;Pigment blue 28 (C.I. 77346);C. I. Pigment Blue 28 (77346)
COBALT BORIDE
CAS:12619-68-0
Formula: B2Co3
198.419998168945
ACM12619680
COBALT BORIDE;cobalt boride, mixture of 2:1 and 3:1;Cobalt boride,mixture of 2:1 and 3:1;Boranetriylcobalt(III);Einecs 235-722-7
COBALT CARBONATE
CAS:513-79-1
Formula: CCoO3
118.94
ACM513791
COBALT(II) CARBONATE, BASIC;COBALT (II) CARBONATE;COBALT CARBONATE;COBALTOUS CARBONATE;c.i.77353;Carbonicacid,cobalt(2+)salt(1:1);carbonicacid,cobalt(2++)salt(1:1);ci77353
COBALT CHROMATE
CAS:12016-69-2
Formula: CoCr2O4
226.92
ACM12016692
COBALT CHROMITE BLUE GREEN SPINEL
CAS:68187-11-1
ACM68187111
COBALT CHROMITE GREEN SPINEL
CAS:68187-49-5
Formula: Co2CrO2OZnO5Sb2
631.83
ACM68187495
COBALT FORMATE
CAS:544-18-3
Formula: (HCO2)2Co
148.96808
ACM544183
cobalt diformate;Diformic acid cobalt(II) salt;NA-9104
COBALT IRON NANOPARTICLES / NANOPOWDER
Formula: Co-Fe
ACM-00000344
Cobalt-iron
COBALT IRON OXIDE NANOPARTICLES / NANOPOWDER
CAS:12052-28-7
Formula: CoFe2O4
234.62
ACM12052287
Cobalt ferrite
COBALT IRON ZINC OXIDE NANOPARTICLE DISPERSION
Formula: Co0.5Zn0.5Fe2O4
ACM-00000363
Cobalt Zinc Iron Oxide, Cobalt Zinc Ferrite, Cobalt Iron Zinc Oxide nanopowder suspension, aqueous Cobalt Iron Zinc Oxide nanoparticle solution, Cobalt Iron Zinc Oxide nanofluid
COBALT IRON ZINC OXIDE NANOPARTICLES / NANOPOWDER
Formula: ZnCoFeO
Varies by composition
ACM-00000304
Cobalt Zinc Iron Oxide
COBALT LITHIUM OXIDE
CAS:12190-79-3
Formula: CoLiO2
97.87
ACM12190793
Lithium colbaltite
COBALT NANOFOIL
CAS:7440-48-4
Formula: CO
58.93
ACM7440484-3
Electrolytic cobalt, electrocobalt, high purity Co
COBALT NANOPARTICLE DISPERSION
CAS:7440-48-4
Formula: CO
58.93
ACM7440484-5
Cobalt nanopowder suspension, aqueous cobalt nanoparticle solution, cobalt nanofluid
COBALT NANORODS
CAS:7440-48-4
Formula: CO
58.93
ACM7440484
Electrolytic cobalt, electrocobalt, high purity Co
COBALT NANOWIRES
CAS:7440-48-4
Formula: CO
58.93
ACM7440484-7
Electrolytic cobalt, electrocobalt, high purity Co
COBALT OXIDE-MOLYBDENUM OXIDE ON ALUMINA (3.5% COO, 14% MOO3)
CAS:1308-06-1
Formula: Co3O4;
240.796g/mol
ACM1308061-1
AN-48997; Cobalt(II,III) oxide, powder, <10 mum; ARONIS24129; cobalt(III) oxide; oxo(oxocobaltiooxy)cobalt; oxo[(oxocobaltio)oxy]cobalt; cobalt(ii; SBB080625; I14-18062; cobalt(II) oxide;
COBALT PHTHALOCYANINE, 92%
CAS:3317-67-7
Formula: C32H16CoN8;
571.469g/mol
ACM3317677
C-23255; Phthalocyanine Cobalt(II); Cobalt(II) phthalocyanine, beta-form, Dye content 97 %; MFCD00010718; AKOS002375071;
COBALT SELENIDE
CAS:1307-99-9
Formula: COSe
137.89
ACM1307999
COBALT SILICIDE
CAS:12017-12-8
Formula: CoSi2
119.14
ACM12017128
COBALT SILICOFLUORIDE
CAS:12021-68-0
Formula: F6SiCo
201.01
ACM12021680
COBALT FLUOROSILICATE;COBALT HEXAFLUOROSILICATE;COBALT SILICOFLUORIDE
COBALT SINGLE CRYSTAL DISC, 10MM (0.39IN) DIA, 2-3MM (0.08-0.1IN) THICK, (0001) ORIENTATION, 0.5
CAS:7440-48-4
ACM7440484-4
COBALT SINGLE CRYSTAL, 10-12MM (0.39-0.47IN) DIA, (0001) ORIENTATION, 2
CAS:7440-48-4
ACM7440484-2
COBALT SINGLE CRYSTAL, 10-12MM (0.39-0.47IN) DIA, RANDOM ORIENTATION
CAS:7440-48-4
ACM7440484-1
COBALT SULFATE HEPTAHYDRATE
CAS:10026-24-1
Formula: CoH14O11S
281.1
ACM10026241
Cobalt(II)sulfate(1:1),heptahydrate;Cobaltmonosulfateheptahydrate;Sulfuricacid,cobalt(2+)salt(1:1),heptahydrate;COBALT(+2)SULFATE HEPTAHYDRATE;COBALT(II) SULFATE;COBALT(II) SULFATE-7-HYDRATE;COBALT(II) SULFATE HEPTAHYDRATE;COBALT (II) SULFATE, HYDROUS
COBALT TETRAFLUOROBORATE HEXAHYDRATE
CAS:15684-35-2
Formula: B2CoF8H12O6
340.63
ACM15684352
COBALT TETRAFLUOROBORATE;COBALT TETRAFLUOROBORATE HEXAHYDRATE;COBALT(II) TETRAFLUOROBORATE HEXAHYDRATE;Cobalt(II) tetrafluoroborate 99%;Cobalt(II)tetrafluoroborate99%;Cobalt fluoroborate;Cobalt(II) tetrafluoroborate hexahydrate,99%;Cobalt(II) tetrafluorob
COBALT TETRAKIS(PENTAFLUOROPHENYL)PORPHYRIN
CAS:52242-06-5
ACM52242065
COBALT THIOCYANATE
CAS:3017-60-5
Formula: C2CoN2S2
175.1
ACM3017605
thiocyanicacid,cobalt(2++)salt;COBALTOUS THIOCYANATE;COBALT THIOCYANATE;COBALT(II) THIOCYANATE;cobalt dithiocyanate;Cobalt(II) thiopcyanate;Cobaltthiopcyanate;Cobalt thiocyanate hydrate
COBALT TRICARBONYL NITROSYL
CAS:14096-82-3
Formula: C3CoNO4
172.97
ACM14096823
COBALT TRICARBONYL NITROSYL;TRICARBONYLNITROSYLCOBALT;Co(CO)3NO;Cobalt, tricarbonylnitrosyl-, (T-4)-
COBALT TUNGSTEN OXIDE(COWO4)
CAS:10101-58-3
Formula: CoWO4
306.7708
ACM10101583
Cobalt tungstate, Cobalt wolframate, Cobalt tungsten oxide (CoWO4), EINECS 233-254-8, 10101-58-3, 23689-74-9
COBALT(2+) SELENITE
CAS:10026-23-0
Formula: CoO3Se
185.8914
ACM10026230
COBALT(II) ACETATE TETRAHYDRATE
CAS:6147-53-1
Formula: C4H6CoO4.4H2O;C4H14CoO8;
249.081g/mol
ACM6147531
cobalt diacetate-tetrahydrate; cobalt(2+) diacetate tetrahydrate; CCRIS 9441; ZBYYWKJVSFHYJL-UHFFFAOYSA-L; 7648Z91O1N; Cobalt(II) acetate tetrahydrate, 98+%; AKOS025243323; Acetic acid, cobalt(2+) salt, tetrahydrate; 6147-53-1; DTXSID80210423;
COBALT(II) ACETYLACETONATE
CAS:14024-48-7
Formula: C10H16CoO4;
259.167g/mol
ACM14024487
Cobalt(II) acetylacetonate, 97%; Cobalt(II) 2,4-pentanedionate; AC1Q1J9L; Bis(2,4-pentanedionato)cobalt; 14024-48-7; (3Z)-4-[({[(2Z)-4-oxopent-2-en-2-yl]oxy}cobaltio)oxy]pent-3-en-2-one;
COBALT(II) BROMIDE HYDRATE
CAS:85017-77-2
Formula: Br2CoH2O;
236.756g/mol
ACM85017772
CTK5F3705; 85017-77-2; ACMC-20alea; 5606AF; DTXSID50583555; Cobalt bromide (CoBr2),hydrate (9CI); AKOS015855120; cobalt(ii) bromide hexahydrate;
COBALT(II) CHLORIDE HEXAHYDRATE
CAS:7791-13-1
Formula: COCl26H2O
129.83(as Anhydrous)
ACM7791131
COBALT(II) ETHYL/BUTYL PHOSPHONATE SILICA (PHOSPHONICS POCO)
ACM-00013535
COBALT(II) FUMARATE
CAS:85187-42-4
172.98948
ACM85187424
COBALT(II) NITRATE HEXAHYDRATE
CAS:10026-22-9
Formula: Co(NO3)2. 6H2O;CoH12N2O12;
291.031g/mol
ACM10026229
cobaltous nitrate 6-hydrate; UNII-2H2166872F; NITRIC ACID, COBALT(2+) SALT, HEXAHYDRATE; Co(NO3)2.6H2O; 8444AF; Co.2NO3.6H2O; Cobalt(II) nitrate hexahydrate, 98+%, ACS reagent; Cobaltousnitratehexahydrate; Cobalt, AAS standard solution, Specpure(R), Co 10
COBALT(II) OXIDE NANOPARTICLES / NANOPOWDER
CAS:1307-96-6
Formula: CoO
74.93
ACM1307966
Cobalt(II) oxide
COBALT(II) STEARATE, 9 - 10% CO
CAS:1002-88-6
Formula: C36H70CoO4;
625.885g/mol
ACM1002886
Cobalt distearate; 000J930IO1; CTK3J8735; RTR-000104; Cobalt(II)Stearate; 1002-88-6; AC1O52V5; SCHEMBL37334; Stearic Acid Cobalt(II) Salt; Octadecanoic acid, cobalt(2+) salt (2:1);
COBALT(II) SULFATE HEPTAHYDRATE
281.10
ACM-00013534
COBALT(II) TETRAPHENYLPORPHYRIN, 97%
CAS:14172-90-8
Formula: C44H28CoN4;
671.669g/mol
ACM14172908
COBALT(II) TRIFLUOROMETHANESULFONATE, 98% (COBALT TRIFLATE)
CAS:58164-61-7
Formula: C2CoF6O6S2;
357.06g/mol
ACM58164617
SCHEMBL428268;Cobalt(II) trifluoromethanesulfonate;bis(trifluoromethanesulfonate)-cobalt(ii);Bis(trifluoromethanesulfonic acid) cobalt(II) salt;58164-61-7;
COBALT(II)1,2,3,4,8,9,10,11,15,16,17,18,22,23,24,25-HEXADECAFLUORO-29H,31H-PHTHALOCYANINE
CAS:52629-20-6
Formula: C32CoF16N8
859.3
ACM52629206
COBALT(II) 1,2,3,4,8,9,10,11,15,16,17,18,22,23,24,25-HEXADECAFLUORO-29H,31H-PHTHALOCYANINE;cobalt 1,2,3,4,8,9,10,11,15,16,17,18,22;COBALT 1,2,3,4,8,9,10,11,15,16,17,18,22,23,24,25-HEXADECAFLUORO-PHTHALOCYANINE;Cobalt(II) 1,2,3,4,8,9,10,11,15,16,17,18,22,2
COBALT(II)2,3-NAPHTHALOCYANINE
CAS:26603-20-3
Formula: C48H24CoN8
771.707
ACM26603203
Cobalt(II) 2,3-naphthalocyanine;Cobalt(II) 2,3-naphthalocyanine Dye content 85 %
COBALT(II)ACETYLACETONATE
CAS:123334-29-2
Formula: C10H14CoO4
257.15
ACM123334292
ACETYLACETONE COBALT(II) SALT;ACETYLACETONE, COBALT(II) DERIVATIVE;2,4-PENTANEDIONE, COBALT(II) DERIVATIVE;COBALTOUS ACETYLACETONATE;COBALT(II) AA;COBALT(II) ACETYLACETONATE HYDRATE;COBALT II 2,4-PENTANEDIONATE, HYDRATE;BIS(ACETYLACETONATO)COBALT(II)
COBALT(II)BROMIDE
CAS:7789-43-7
Formula: Br2Co
218.74
ACM7789437
COBALT(II) BROMIDE;COBALT BROMIDE;COBALT(+2)BROMIDE;COBALTOUS BROMIDE;Cobalt bromide (CoBr2);cobalt(ii)bromideanhydrous;cobaltbromide(cobr2);cobaltdibromide
COBALT(II)CARBONATE HYDRATE
CAS:57454-67-8
Formula: CH2CoO4
136.95738
ACM57454678
COBALT(II) CARBONATE HYDRATE, 99.998%;COBALT(II) CARBONATE HYDRATE, APPROX. 43-47% CO;Cobalt(II) carbonate hydrate >=99.99% trace metals basis;Cobalt(II) carbonate hydrate Vetec(TM) reagent grade
COBALT(II)CHLORIDE HYDRATE
CAS:69098-14-2
Formula: Cl2CoH2O
147.85
ACM69098142
COBALT(II) CHLORIDE HYDRATE;COBALT(II) CHLORIDE HYDRATE, 99.999%;Cobalt(II) Chloride 99.9%;Cobalt(II) chloride hydrate 99.999% trace Metals basis
COBALT(II)CYANIDE
CAS:20427-11-6
Formula: C2H4CoN2O2
147
ACM20427116
COBALT(II) CYANIDE;COBALT(II) CYANIDE DIHYDRATE
COBALT(II)FLUORIDE TETRAHYDRATE
CAS:13817-37-3
Formula: CoF2H8O4
168.99
ACM13817373
COBALTOUS FLUORIDE 4H2O;COBALT(II) FLUORIDE TETRAHYDRATE;Cobaltfluoridetetrahydrate;COBALT(II) FLUORIDE TETRAHYDRATE, 99.99%;cobalt(ii) fluoride tetrahydrate, puratronic;Cobalt(II) fluoride tetrahydrate, Puratronic(R), 99.99% (metals basis);Cobalt(II) flu
COBALT(II)HEXAFLUOROACETYLACETONATE
CAS:206986-92-7
Formula: Co(C5HF6O2)2xH2O
473.03
ACM206986927
COBALT(II)IODIDE
CAS:15238-00-3
Formula: CoI2
312.74
ACM15238003
cobaltiodide(coi2);COBALT IODIDE;COBALT(II) IODIDE;COBALTOUS IODIDE;cobalt diiodide;Cobaltiodideanhydrous;Cobalt(?) iodide dihydrate;COBALT(II) IODIDE, ANHYDROUS, POWDER, 99 .999%
COBALT(II)OXALATE DIHYDRATE
CAS:5965-38-8
Formula: C2H4CoO6
182.98
ACM5965388
Cobaltousoxalatedihydrate;COBALT(+2)OXALATE DIHYDRATE;COBALT(II) OXALATE DIHYDRATE;COBALT OXALATE DIHYDRATE;COBALT(II) OXALATE 4 H2O;COBALT OXALATE REAGENT;cobalt(ii) oxalate dihydrate, puratronic;COBALT (LL) OXALATE DIHYDRATE
COBALT(II)PERCHLORATE
CAS:13478-33-6
Formula: Cl2CoH12O14
365.93
ACM13478336
cobaltdiperchloratehexahydrate;cobaltousperchlorate,hexahydrate;perchloricacid,cobalt(ii)salt,hexahydrate;COBALT(+2)PERCHLORATE HEXAHYDRATE;COBALT (II) PERCHLORATE;COBALT(II) PERCHLORATE HEXAHYDRATE;COBALT(II)PERCHLORATE HYDRATE;COBALTOUS PERCHLORATE
COBALT(II)PHOSPHATE OCTAHYDRATE
CAS:10294-50-5
Formula: Co3H16O16P2
510.86
ACM10294505
phosphoricacid,cobalt(2+)salt(2:3),octahydrate;COBALT PHOSPHATE, HYDROUS;COBALT PHOSPHATE OCTAHYDRATE;COBALT(II) PHOSPHATE OCTAHYDRATE;COBALT(II) PHOSPHATE;COBALT ORTHOPHOSPHATE;COBALT PHOSHATE HYDRATE;Cobalt orthophosphate,hydrous
COBALT(II)SULFATE HYDRATE
CAS:60459-08-7
Formula: CoH2O5S
173.01
ACM60459087
COBALT(II) SULFATE;COBALT(II) SULFATE HYDRATE;COBALTOUS SULFATE HYDRATE;COBALTOUS SULFATE MONOHYDRATE;COBALT SULFATE HYDRATE;COBALT SULFATE MONOHYDRATE;Cobalt(?) sulfate anhydrous;Cobalt(II) sulfate hydrate, 99.998% metals basis
COBALT(III)HYDROXIDE
CAS:21041-93-0
Formula: CoH3O3
109.95522
ACM21041930
COBALT(IV)SULFIDE
CAS:12013-10-4
Formula: CoS2
123.06
ACM12013104-1
cobaltsulfide(cos2);cobaltsulfide(crystalline);COBALT SULFIDE;COBALT (IV) SULFIDE;COBALT DISULFIDE;Cobalt(IV)sulfide,99.5%(metalsbasisexcludingNi),Ni;cobalt(III) sulfide
COBALT-DPPE HETEROGENEOUS WATER OXIDATION CATALYST (~17%-CO)
Formula: C26H24CoP2
ACM-00013536
COBALTIC NITRATE
CAS:15520-84-0
ACM15520840
COBINAMIDE DICYANIDE
CAS:27792-36-5
Formula: C50H73CoN13O8
1043.13
ACM27792365
ETIOCOBALAMIN, FACTOR B;COBINAMIDE DICYANIDE;dicyanocobinamide;etiocobalamin;Cobinamidedicyanide,Etiocobalamin,FactorB
COBOLT-3-OXIDE;COBALITIC OXIDE
CAS:1308-04-9
Formula: Co2O3
165.86
ACM1308049
COBALT(III) OXIDE BLACK
COBRATEC #99
CAS:27556-51-0
Formula: C6H5N3
119.127
ACM27556510
COCAL
CAS:21834-92-4
Formula: C13H16O
188.27
ACM21834924
FEMA 3199;Cocal;2-PHENYL-5-METHYL-2-HEXENAL;5-METHYL-2-PHENYLHEX-2-ENAL;5-METHYL-2-PHENYL-2-HEXENAL;(2E)-5-Methyl-2-phenyl-2-hexenal;.alpha.-(3-methylbutylidene)-Benzeneacetaldehyde;alpha-(3-methylbutylidene)-benzeneacetaldehyd
COCAMIDOPROPYL BETAINE
CAS:86438-79-1
Formula: C19H38N2O3
342.52
ACM86438791
COCO OLEAMIDOPROPYL BETAINE;Mirataine CB;cocoamphodiproprionate;1-propanaminium, N-carboxymethyl-N,N-dimethyl-3-amino-, N-(mixed coco acyl and 9-octadecenoyl) derivs., hydroxides, inner salts;1-propanaminium,N-carboxymethyl-N,N-dimethyl-3-amino-,N-(mixed
COCARBOXYLASE
CAS:154-87-0
Formula: C12H19N4O7P2S.Cl
460.77
ACM154870
THIAMINIUM DIPHOSPHORIC ACID ESTER CHLORIDE;THIAMINIUM PYROPHOSPHATE CHLORIDE;THIAMINIUM PYROPHOSPHORIC ACID ESTER CHLORIDE;THIAMINE PYROPHOSPHATE;THIAMINE PYROPHOSPHATE CHLORIDE;THIAMINEPYROPHOSPHORIC ACID;THIAMINE PYROPHOSPHORIC ACID ESTER CHLORIDE;VITA
COCO MONOETHANOLAMIDE
CAS:68140-00-1
Formula: CH3(CH2)nC(=O)N (CH3OH)2
ACM68140001
Coco monoethanolamide;Coconut fatty acid monoethanolamide;Coconut monoethanolamide
COCOA,EXT.
CAS:84649-99-0
0
ACM84649990
Cocoa, ext.;THEOBROMA CACAO (COCOA) EXTRACT;Cocoaextract;CACAO EXTRACT;COCOAPOWDEREXTRACT
COCOAMIDOPROPYL BETAINE
CAS:86243-76-7
ACM86243767
COCOAMINE
CAS:61788-46-3
Formula: C38H46N2O8
0
ACM61788463
Amines,cocoalkyl;COCAMINE;Cocoamine (distilled);cocoalkylamine,distilled;Cocoamine,destillliert;(Coconut oil alkyl) amine;Cocoanut oil amine;COCOALKYLAMINES
COCOAMINE ACETATE
CAS:61790-57-6
0
ACM61790576
alkylamine;alkylamineacetate;amines,cocoalkyl,acetates;Amine, Kokos-alkyl-, Acetate;Cocamine acetate;cocoamine,acetates
COCONUT DIETHANOLAMIDE
CAS:68603-42-9
Formula: NO
0
ACM68603429
amides,coco,n,n-bis(2-hydroxyethyl);Amides,coco,N,N-bis(hydroxyethyl);clindrol200cgn;clindrol202cgn;clindrolsuperamide100cg;Coconutacid,diethanolamide;coconutdiethanolamine;Coconutfattyacidamideofdiethanolamine
COCONUT OIL
CAS:8001-31-8
Formula: N/A
0
ACM8001318
Acidulatedcoconutsoapstock;Coconutacidulatedsoapstock;coconutbutter;Coconutextract;coconutoilfromcocosnucifera;coconutpalmoil;freecoconutoil;oils,coconut
CODEINE PHOSPHATE
CAS:52-28-8
Formula: C18H22NO6P
379.344141
ACM52288
CodeinePhosphate[D.D];(5a,6a)-7,8-Didehydro-4,5-epoxy-3-methoxy-17-methyl-morphinan-6-ol Phosphate;Codicept Phosphate;Coducept Phosphate;Galcodine;Morphine 3-Methyl Ether Phosphate;Tricodein;Morphinan-6-ol, 7,8-didehydro-4,5-epoxy-3-methoxy-17-methyl-, (5
CODEINE PHOSPHATE,SEQUIHYDRATE)
CAS:5913-76-8
0
ACM5913768
CODEINE PHOSPHATE, SEQUIHYDRATE)
COELENTERAZINE E
CAS:114496-02-5
Formula: C28H23N3O3
449.508
ACM114496025
COELENTERAZINE FCP
CAS:123437-33-2
Formula: C25H24FN3O2
417.48
ACM123437332
123437-33-2, 8-(cyclopentylmethyl)-2-[(4-fluorophenyl)methyl]-6-(4-hydroxyphenyl)-imidazo[1,2-a]pyrazin-3(7H)-one
COELENTERAZINE H
CAS:50909-86-9
Formula: C26H21N3O2
407.46
ACM50909869
COENZYME A
CAS:85-61-0
Formula: C21H36N7O16P3S
767.54
ACM85610
COENZYME A HYDRATE;COENZYME A;COA;COA-SH;Coenzyme a, free acid;Coenzyme A, free acid, lyophilized, min. 75% (enzym.);COENZYME A FREE ACID FROM YEAST;Coenzyme A, free acid, lyophilized, 75%
COENZYME A DISULFIDE,OCTALITHIUM SALT(9CI)
CAS:102778-59-6
Formula: C42H70N14O32P6S2.8Li
821.36
ACM102778596
COENZYME A HEXALITHIUM SALT OXIDIZED;COENZYME A, OXIDIZED LITHIUM SALT;COENZYME A TRILITHIUM SALT DIHYDRATE;COA-S-S-COA-LI6;COENZYME A, OXIDIZED LITHIUM;coenzyme A hexalithium salt oxidised;CoA-S-S-CoA
COENZYME A,S-BUTANOATE,TRILITHIUM SALT(9CI)
CAS:102282-28-0
Formula: C25H42N7O17P3S.3Li
861.36
ACM102282280
N-BUTYRYL COENZYME A LITHIUM SALT;BUTYRYL COENZYME A;BUTYRYL COENZYME A DILITHIUM SALT;C4:0;butyryl coenzyme a lithium salt hydrate;Butyryl coenzyme A lithium salt;Butyryl-Coenzym A Dilithiumsalz;coenzyme A n-butyryl derivative (C4:0), lithium salt
COENZYME A,S-HEXADECANOATE
CAS:1763-10-6
Formula: C37H66N7O17P3S
1044.03
ACM1763106
PALMITOYL COENZYME A, K SALT;PALMITOYL COENZYME A POTASSIUM SALT;N-HEXADECANOYL COENZYME A, POTASSIUM;N-HEXADECANOYL COENZYME A POTASSIUM SALT;S-palmitoylcoenzyme A;[5-(6-aminopurin-9-yl)-2-[[[[3-[2-(2-hexadecanoylsulfanylethylcarbamoyl)ethylcarbamoyl]-3
COENZYME A,S-OCTADECANOATE
CAS:362-66-3
Formula: C39H70N7O17P3S
1033.9961
ACM362663
stearyl-CoA; Octadecanoyl-coenzyme A; S-Stearoylcoenzyme A; Octadecanoyl-CoA; Stearoyl coenzyme A ester; S-[2-[3-[[(2R)-4-[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-4-hydroxy-3-phosphonooxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-hydroxyphosphoryl]oxy-2-hydr
COENZYME Q1
CAS:727-81-1
Formula: C14H18O4
250.29
ACM727811
COENZYME Q10(H-10)
CAS:3073-95-8
0
ACM3073958
coenzyme Q10(H-10)
COG 133 TRIFLUOROACETATE SALT
CAS:514200-66-9
Formula: C97H181N37O19
2169.71 (free base basis)
ACM514200669
COL ACETATE
CAS:14586-35-7
Formula: C7H16NO2+
146.21
ACM14586357
COLASOVE OES
CAS:68039-12-3
Formula: C24H48N2O5S
ACM68039123
COLESTILAN
CAS:95522-45-5
Formula: C6H9N2OX2.Cl
160.603
ACM95522455
Colestilan;Colestilan chloride;Colestimide;Epichlorohydrin-2-methylimidazole copolymer
COLIPASE
CAS:55126-92-6
0
ACM55126926
COLIPASE;colipase from hog pancreas;colipase from porcine pancreas;Lipase cofactor
COLLAGEN
CAS:9007-34-5
Formula: NULL
ACM9007345-2
Collagenpowder;collagens;BOVINE COLLAGEN TYPE II;COLLAGEN TYPE IV, HUMAN;COLLAGEN, TYPE IV, HUMAN PLACENTA;COLLAGEN TYPE IV (HU PLACENTA);COLLAGEN TYPE V (HU PLACENTA);COLLAGEN, TYPE 5
COLLAGEN
CAS:9064-67-9
Formula: C4H6N2O3R2.(C7H9N2O2R)n
0
ACM9064679-1
CELLAGEN(TM) BEADS;CELLAGEN(TM) SOLUTION AC-3;CELLAGEN(TM) SOLUTION AC-5;CELLAGEN(TM) SOLUTION EMEM;CELLAGEN(TM) SOLUTION PC-3;CELLAGEN(TM) SOLUTION PC-5;CELLAGEN(TM) SOLUTION T-IV;CELLAGEN(TM) SOLUTION WITH DMEM
COLLAGENASE CHROMOPHORE SUBSTRATE TEST SUBSTANCE
CAS:98640-71-2
Formula: C25H30N4O5
466.53
ACM98640712
4-Phenylazobenzyloxycarbonyl-Pro-Leu-OH, Collagenase Chromophore Substrate Test Substance, 98640-71-2
COLLAGENASE-CHROMOPHORE-SUBSTRATE,COMPONENT A
CAS:118081-33-7
Formula: C38H52N10O82H2O
812.91
ACM118081337
Collagenase Chromophore-Substrate, 4-Phenylazobenzyloxycarbonyl-Pro-Leu-Gly-Pro-D-Arg-OH dihydrate, 118081-33-7
COLLISMYCIN
CAS:158792-24-6
Formula: C13H13N3O2S
275.30
ACM158792246
COLLISMYCIN A
COLLISMYCIN
CAS:158792-24-6
Formula: C13H13N3O2S
275.30
ACM158792246
COLLISMYCIN A
COLLOIDAL GRAPHITE POWDER
CAS:7782-42-5
ACM7782425-10
COLOMINIC ACID SODIUM SALT
CAS:70431-34-4
Formula: C33H48N3Na3O25X2
955.71
ACM70431344
COLORFORMER YELLOW CK-37
CAS:144190-25-0
Formula: C33H38N2O
478.67
ACM144190250
Copikem 37
COLORFORMER YELLOW CK-37
CAS:144190-25-0
Formula: C33H38N2O
478.67
ACM144190250
Copikem 37
COMANIC ACID
CAS:499-05-8
Formula: C6H4O4
140.09
ACM499058
Comanic Acid, 499-05-8, 4-Oxo-4H-pyran-2-carboxylic Acid, gamma-Pyrone-2-carboxylic Acid, AKOS006227995, BP-10232, I14-60564
COMMIPHORA EXTRACT
CAS:100084-96-6
ACM100084966
COMPOUND 401
CAS:168425-64-7
Formula: C16H15N3O2
C16H15N3O2
ACM168425647
COMU
CAS:1075198-30-9
Formula: C12H19N4O4.PF6
0
ACM1075198309
(1-Cyano-2-ethoxy-2-oxoethylidenaminooxy)dimethylamino-morpholino-carbenium hexafluorophosphate;4-{{[(1-Cyano-2-ethoxy-2-oxoethylidene)amino]oxayl] (dimethylamino)methylene]-hexafluorophosphate;1-[1-(Cyano-2-ethoxy-2-oxoethylideneaMinooxy)-diMethylaMino-M
CONCANAMYCIN A
CAS:80890-47-7
Formula: C46H75NO14
866.09
ACM80890477
CONDELPHINE
CAS:7633-69-4
Formula: C25H39NO6
449.58
ACM7633694
CONDUCTIVE CARBON BLACK
CAS:7440-44-0
ACM7440440-211
CONDUCTIVE CARBON NANOTUBE FILM(10CM X 10CM)
CAS:308068-56-6
ACM308068566-12
CONDUCTIVE CARBON NANOTUBE FILM(30CM X 30CM)
CAS:308068-56-6
ACM308068566-13
CONDUCTIVE CARBON NANOTUBE FILM(5CM X 5CM)
CAS:308068-56-6
ACM308068566-17
CONDUCTIVE CARBON NANOTUBE TAPE
CAS:308068-56-6
ACM308068566-10
CONDUCTIVE FLEXIBLE TPU FILAMENT
CAS:7440-44-0
ACM7440440-171
CONDUCTIVE GRAPHENE FILAMENT,3D PRINTING MATERIALS
CAS:7440-44-0
ACM7440440-181
CONDUCTIVE NANOSILVER INK
CAS:7440-22-4
ACM7440224-16
CONDUCTIVE SILVER SLURRY
CAS:7440-22-4
ACM7440224-11
CONGO RED
CAS:573-58-0
Formula: C32H22N6Na2O6S2
696.66
ACM573580
CONIFERIN
CAS:531-29-3
Formula: C16H22O8
342.34
ACM531293
b-Glucopyranoside, 4-(3-hydroxy-1-propen-1-yl)-2-methoxyphenyl
CONIFERYL ALCOHOL
CAS:458-35-5
Formula: C10H12O3
180.2
ACM458355
2-METHOXY-4-(G-HYDROXY)-PROPENYL PHENOL;3-(4-HYDROXY-3-METHOXYPHENYL)-2-PROPEN-1-OL;4-(3-HYDROXYPROP-1-ENYL)-2-METHOXYPHENOL;4-HYDROXY-3-METHOXYCINNAMIC ALCOHOL;4-HYDROXY-3-METHOXYCINNAMYL ALCOHOL;G-HYDROXY ISOEUGENOL;CONIFERYL ALCOHOL;2-Propen-1-ol, 3-(4
CONIVAPTAN
CAS:210101-16-9
Formula: C32H26N4O2
498.583
ACM210101169
CONIVAPTAN;N-[4-[(4,5-Dihydro-2-methylimidazo[4,5-d][1]benzazepin-6(1H)-yl)carbonyl]phenyl]-[1,1-biphenyl]-2-carboxamide
CONJUGATED LINOLEIC ACID
CAS:121250-47-3
Formula: C18H32O2
280.45
ACM121250473
CIS-10,CIS-12-OCTADECADIENOICACID; 9,11-Octadecadienoic acid; Conjugated Linolenic Acid,CLA; TRANS-10,TRANS-12-OCTADECADIENOICACID; CIS-10-CIS-12-CONJUGATEDLINOLEICACID; 9,11-Linoleic acid;
CONJUGATED LINOLEIC ACID(9E,11E)
CAS:544-71-8
Formula: C18H32O2
280.45
ACM544718
9-cis-11-trans-linoleic acid; trans-11-conjugated linoleic acid; cis-9,trans-11 conjugated linoleic acid; 9,11-cis,trans-octadecanoic acid;
COOMASSIE FAST BLACK G
CAS:10142-78-6
Formula: C37H25N5Na2O6S2
745.73
ACM10142786
COOMASSIE FAST BLACK G;disodium 5-[[4-[(5-sulphonato-1-naphthyl)azo]-1-naphthyl]azo]-8-(p-tolylamino)naphthalene-1-sulphonate;Acid black 21 (C.I. 26405);4-[(4-Methylphenyl)amino]-4'-[(5-sodiosulfo-1-naphthalenyl)azo][1,1'-azobisnaphthalene]-5-sulfonic ac
COPEPTIN TRIFLUOROACETATE HUMAN
CAS:78362-34-2
4021.40 (free base basis)
ACM78362342
COPHYLLINE
CAS:142741-24-0
Formula: C44H50N4O10
0
ACM142741240
Cophylline;Vinca alkaloid III-121C
COPPER
CAS:7440-50-8
Formula: Cu;
63.546g/mol
ACM7440508-9
CHEBI:28694; Copper, rod, 200mm, diameter 2.0mm, as drawn, 99.99+%; Copper, wire reel, 5m, diameter 0.75mm, as drawn, 99.98+%; Copper, rod, 200mm, diameter 9.5mm, hard, 99.9%; Copper, foil, thickness 0.25 mm, length 2 m, purity 99.9%; Copper, foil, thickn
COPPER (I) DIPHENYLPHOSPHINATE
CAS:1011257-42-3
Formula: C12H10CuO2P;
280.73g/mol
ACM1011257423
SCHEMBL1333677; Copper (I) diphenylphosphinate; TC-068616; MFCD09702021; AKOS015840647; Phosphinic acid, P,P-diphenyl-, copper(1+) salt (1:1); $l^{1}-copper(1+) ion diphenylphosphinate; 1011257-42-3; FT-0685402; Y6783;
COPPER (I) TELLURIDE (CU2TE, 4N-6N)
CAS:12019-52-2
Formula: Cu2Te
254.69
ACM12019522
COPPER (II) METHACRYLATE
CAS:53721-10-1
Formula: C8H10CuO4
233.7
ACM53721101
COPPER 1,3-DIPHENYL-1,3-PROPANEDIONATE
CAS:14405-48-2
Formula: C30H22CuO4
510.04
ACM14405482
BIS(DIBENZOYLMETHANATO)COPPER;COPPER 1,3-DIPHENYL-1,3-PROPANEDIONATE
COPPER ALUMINUM OXIDE NANOPARTICLES / NANOPOWDER
CAS:12042-92-1
Formula: CuAl2O4
181.51
ACM12042921
Dialuminium copper tetraoxide
COPPER CAPRYLATE
CAS:3890-89-9
Formula: C16H30CuO4
349.95
ACM3890899
COPPER CARBON NANOTUBE
Formula: Cu-C
ACM-00000224
Copper-graphite composite nanotubes, copper-coated CNTs, Cu-C NTs
COPPER CHROMITE
CAS:12053-18-8
Formula: Cr2CuO4
231.54
ACM12053188
COPPER(II) CHROMITE;COPPERCHROMIUM OXIDE;COPPER CHROMITE CATALYST;CopperChromite(Ba/MnPromoted);copper(ii) chromium(iii) oxide;COOPER CHROMITE;Einecs 235-000-1
COPPER CHROMITE
CAS:12053-18-8
Formula: Cr2CuO4
231.54
ACM12053188
COPPER(II) CHROMITE;COPPERCHROMIUM OXIDE;COPPER CHROMITE CATALYST;CopperChromite(Ba/MnPromoted);copper(ii) chromium(iii) oxide;COOPER CHROMITE;Einecs 235-000-1
COPPER CHROMITE, BARIUM PROMOTED (62-64% CR2CUO4, 22-24% CUO, 6%BAO, 0-4% GRAPHITE, 1% CRO3, 1% CR2O3)
CAS:12018-10-9
Formula: Cr2CuO4;
231.534g/mol
ACM12018109
CuCr2O4; 12018-10-9; Oxocopper; oxo-(oxochromiooxy)chromium; MFCD00044868; CTK0I1166; Cr2O3.CuO;
COPPER CHROMITE, CATALYST
CAS:11104-65-7
Formula: CuCr
231.54
ACM11104657
COPPER CHROMITE CATALYST;COPPERCHROMIUM OXIDE;COPPER(II) CHROMITE;Chromium copper oxide
COPPER DIIRON TETRAOXIDE
CAS:12018-79-0
Formula: CuFe2O4
239.23
ACM12018790
Copper ferrite, Copper iron oxide, 641723_ALDRICH, MolPort-003-938-114, 12018-79-0, 37220-43-2
COPPER DISODIUM EDTA
CAS:14025-15-1
Formula: C10H12CuN2Na2O8
397.74
ACM14025151
copper disodium edta;Copper disodium ethylenediaminetetraacetate;ETA-NA2-CU TETRAHYDRATE;EDTA-2NACU TETRAHYDRATE;ETHYLENEDIAMINETETRAACETIC ACID DISODIUM COPPER SALT (TETRAHYDRATE);ETHYLENEDIAMINETETRAACETIC ACID COPPER DISODIUM SALT TETRAHYDRATE;((ethyle
COPPER FOIL
ACM-00000269
COPPER FORMATE
153.58
ACM-00013540
COPPER FORMATE
CAS:544-19-4
Formula: C2H2CuO4
153.58
ACM544194
COPPER (II) FORMATE;CUPRIC FORMATE;COPPER FORMATE;cupricdiformate;formicacid,copper(2+)salt;formicacid,copper(2+)salt(1:1);formicacid,copper(2++)salt;copper diformate
COPPER FORMATE
CAS:544-19-4
Formula: C2H2CuO4
153.58
ACM544194
COPPER (II) FORMATE;CUPRIC FORMATE;COPPER FORMATE;cupricdiformate;formicacid,copper(2+)salt;formicacid,copper(2+)salt(1:1);formicacid,copper(2++)salt;copper diformate
COPPER FORMATE
Formula: C2H2CuO4
153.58
ACM544194
COPPER (II) FORMATE;CUPRIC FORMATE;COPPER FORMATE;cupricdiformate;formicacid,copper(2+)salt;formicacid,copper(2+)salt(1:1);formicacid,copper(2++)salt;copper diformate
COPPER HEXAFLUOROSILICATE HYDRATE
CAS:12062-24-7
Formula: CuF6Si
205.62
ACM12062247
copper fluorosilicate;
COPPER HYDRIDE (CUH) SOLUTION
CAS:13517-00-5
Formula: CuH
64.55
ACM13517005
Copper Monohydride, Copper hydride (CuH), AC1MNYC0, CTK4B9693, AG-D-71984, Coppermonohydride; Copper(I) hydride; Cuprous hydride, 13517-00-5
COPPER HYDROXIDE
CAS:1344-69-0
97.5607
ACM1344690
Einecs 215-705-0;Pei 24
COPPER I / II HEXAFLUOROPENTANEDIONATE-VINYLTRIMETHYLSILANE COMPLEX
CAS:139566-53-3
Formula: C10H13F6O2CuSi
0
ACM139566533
COPPER I / II HEXAFLUOROPENTANEDIONATE - VINYLTRIMETHYLSILANE COMPLEX;COPPER(I)/(II) HEXAFLUORO-2,4-PENTANEDIONATE - VINYLTRIMETHYLSILANE COMPLEX
COPPER I HEXAFLUOROPENTANEDIONATE-2-BUTYNE COMPLEX
CAS:137007-13-7
Formula: C9H7CuF6O2
324.69
ACM137007137
COPPER(I)HEXAFLUOROPENTANEDIONATE-2-BUTYNE;COPPER I HEXAFLUOROPENTANEDIONATE-2-BUTYNE COMPLEX;Copper(I) hexafluoroacetylacetonate-2-butyne complex;COPPER(I) HEXAFLUORO-2,4-PENTANEDIONATE 2-BUTYNE COMPLEX
COPPER II DIMETHYLAMINOETHOXIDE
CAS:41119-18-0
Formula: C8H20CuN2O2
239.8
ACM41119180
COPPER II DIMETHYLAMINOETHOXIDE;Copperdimethylaminoethoxide;Copper ? dimethylaminoethoxide
COPPER II DIMETHYLAMINOETHOXIDE
CAS:41119-18-0
Formula: C8H20CuN2O2
239.8
ACM41119180
COPPER II DIMETHYLAMINOETHOXIDE;Copperdimethylaminoethoxide;Copper ? dimethylaminoethoxide
COPPER II METHACRYLATE,MONOHYDRATE
CAS:19662-59-0
Formula: C8H12CuO5
251.72
ACM19662590
COPPER II METHACRYLATE, MONOHYDRATE;Coppermethacrylatemonohydrate;copper methacrylate;Copper(II) methacrylate hydrate;copper(ii) methacrylate hydrate, tech.;Copper(II) Methacrylate, tech.
COPPER IN CHARCOAL
Formula: Cu/C
ACM-00013541
COPPER INDIUM GALLIUM SELENIDE NANOPARTICLES
Formula: CuInxGa(1-x)Se2
Varies by composition
ACM-00000390
Copper indium gallium diselenide
COPPER INDIUM SELENIDE NANOPARTICLES
CAS:12018-95-0
Formula: CuInSe2
336.28
ACM12018950
indium(+3) cation
COPPER IODIDE DIMETHYL SULFIDE COMPLEX
CAS:914915-20-1
Formula: C6H18Cu4I4S3
948.20
ACM914915201
Copper iodide dimethyl sulfide complex, 914915-20-1, CTK8E9081, |I-Iodotri-|I3-iodotris[thiobis[methane]]tetracopper
COPPER IRON OXIDE NANOPARTICLES / NANOPOWDER
CAS:12018-79-0
Formula: CuFe2O4
239.23
ACM12018790-1
Copper ferrite
COPPER MOLYBDATE
CAS:13767-34-5
Formula: CuMoO4
223.48
ACM13767345
CUPRIC MOLYBDATE;COPPER(II) MOLYBDATE;COPPER MOLYBDATE;COPPER MOLYBDENUM OXIDE;copper molybdenum tetraoxide;Molybdic acid copper(II) salt
COPPER NANOFOIL
CAS:7440-50-8
Formula: Cu
63.55
ACM7440508-8
Copper OFC, Oxygen-free Copper, Copper OFHC, Oxygen-free high thermal conductivity copper, Copper OFE, Oxygen free electrolytic copper, Oxygen Free Electronic Copper, ASTM F68, Copper Alloy 101, C101, C102, C10100, C10200 Copper O, High-conductivity coppe
COPPER NANORODS
CAS:7440-50-8
Formula: Cu
63.55
ACM7440508-2
Copper OFC, Oxygen-free Copper, Copper OFHC, Oxygen-free high thermal conductivity copper, Copper OFE, Oxygen free electrolytic copper, Oxygen Free Electronic Copper, ASTM F68, Copper Alloy 101, C101, C102, C10100, C10200 Copper O, High-conductivity coppe
COPPER NANOTUBES
CAS:7440-50-8
Formula: Cu
63.55
ACM7440508-1
Copper OFC, Oxygen-free Copper, Copper OFHC, Oxygen-free high thermal conductivity copper, Copper OFE, Oxygen free electrolytic copper, Oxygen Free Electronic Copper, ASTM F68, Copper Alloy 101, C101, C102, C10100, C10200 Copper O, High-conductivity coppe
COPPER NANOWIRES
CAS:7440-50-8
Formula: Cu
63.55
ACM7440508-5
Copper OFC, Oxygen-free Copper, Copper OFHC, Oxygen-free high thermal conductivity copper, Copper OFE, Oxygen free electrolytic copper, Oxygen Free Electronic Copper, ASTM F68, Copper Alloy 101, C101, C102, C10100, C10200 Copper O, High-conductivity coppe
COPPER NICKEL NANOPARTICLES
Formula: Cu-Ni
ACM-00000303
COPPER NITRATE BASIC
CAS:12158-75-7
Formula: CuN2O6
187.56
ACM12158757
Tetrakupfer(II)hexahydroxynitrat;Basic copper nitrate;Copper nitrate basic;Cupric nitrate,basic;Cupric hydroxide nitrate;Dicopper nitrate trihydroxide;Trihydroxo(nitrato)dicopper
COPPER OXIDE NANO-CHAINS
CAS:1317-38-0
ACM1317380-1
COPPER OXIDE NANOPARTICLES / NANOPOWDER
CAS:1317-38-0
Formula: CuO
79.55
ACM1317380-2
Copper(II) oxide nanopowder
COPPER OXYCHLORIDE
CAS:1332-40-7
Formula: Cl2Cu.3CuH2O2
427.13
ACM1332407
BLITOX;FUNGURAM;CUPRIC OXYCHLORIDE;CUPRAVIT;CUPOX;CUPROKYLT;COBOX;COPRANTOL
COPPER PHOSPHIDE, CONTAINING MORE THAN 15 PER CENT BY WEIGHT OF PHOSPHORUS
CAS:12134-35-9
ACM12134359
COPPER PHTHALATE
CAS:10027-30-2
Formula: C8H4CuO4
227.660960 [g/mol]
ACM10027302
Copper phthalate, CID82304, EINECS 233-068-7, AI3-17215, 1,2-Benzenedicarboxylic acid, copper(2+) salt, 10027-30-2
COPPER PHTHALOCYANINE TETRASULFONIC ACID TETRASODIUM SALT
CAS:27360-85-6
Formula: C32H12CuN8Na4O12S4
984.25
ACM27360856
Cuprate(4-),[29H,31H-phthalocyanine-C,C,C,C-tetrasulfonato(6-)-N29,N30,N31,N32]-,tetrasodium;COPPER(II) PHTHALOCYANINE TETRASULFONIC ACID TETRASODIUM SALT;COPPER PHTHALOCYANINE TETRASULFONIC ACID TETRASODIUM SALT;PHTHALOCYANINE-TETRASULFONIC ACID COPPER(I
COPPER PHTHALOCYANINE TETRASULFONIC ACID TETRASODIUM SALT
CAS:27360-85-6
Formula: C32H12CuN8Na4O12S4
984.25
ACM27360856
Cuprate(4-),[29H,31H-phthalocyanine-C,C,C,C-tetrasulfonato(6-)-N29,N30,N31,N32]-,tetrasodium;COPPER(II) PHTHALOCYANINE TETRASULFONIC ACID TETRASODIUM SALT;COPPER PHTHALOCYANINE TETRASULFONIC ACID TETRASODIUM SALT;PHTHALOCYANINE-TETRASULFONIC ACID COPPER(I
COPPER PHYTATE
CAS:63903-50-4
Formula: C6H6Cu6O24P6
1029.22
ACM63903504
myo-Inositol hexakis(dihydrogen phosphate) Copper salt;copper phytate;myo-Inositol hexakis[phosphoric acid copper(II)] salt;Phytic acid hexacopper(II)salt;Myo-inositol, hexakis(dihydrogen phosphate), copper(2+) salt (1:6);Nsc402433
COPPER PYROPHOSPHATE
CAS:16570-28-8
Formula: Cu2P2O7
ACM16570288
Diphosphoric acid copper(2+) salt hydrate
COPPER SILICIDE
CAS:12159-07-8
Formula: Cu5Si
345.82
ACM12159078
COPPER SINGLE CRYSTAL DISC, 10MM (0.39IN) DIA, 1-3MM (0.04-0.1IN) THICK, (100) ORIENTATION
CAS:7440-50-8
ACM7440508-11
COPPER SINGLE CRYSTAL DISC, 10MM (0.39IN) DIA, 1-3MM (0.04-0.1IN) THICK, (110) ORIENTATION
CAS:7440-50-8
ACM7440508-3
COPPER SINGLE CRYSTAL DISC, 10MM (0.39IN) DIA, 1-3MM (0.04-0.1IN) THICK, (111) ORIENTATION
CAS:7440-50-8
ACM7440508-6
COPPER SINGLE CRYSTAL, 15MM (0.59IN) DIA, 50MM (2.0IN) LONG, (100) ORIENTATION
CAS:7440-50-8
ACM7440508-10
COPPER SINGLE CRYSTAL, 15MM (0.59IN) DIA, 50MM (2.0IN) LONG, (110) ORIENTATION, 2
CAS:7440-50-8
Formula: Cu
63.55
ACM7440508-7
Copper OFC
COPPER SINGLE CRYSTAL, 15MM (0.59IN) DIA, 50MM (2.0IN) LONG, (111) ORIENTATION
CAS:7440-50-8
Formula: Cu
63.55
ACM7440508-4
Copper nanoparticle suspension
COPPER SINGLE CRYSTAL, 15MM (0.59IN) DIA, 50MM (2.0IN) LONG, RANDOM ORIENTATION
CAS:7440-50-8
Formula: Cu
63.55
ACM7440508
Copper nanowire suspension
COPPER ZINC FERRITE NANOPARTICLES / NANOPOWDER
CAS:228402-49-1
Formula: CuFe2O4Zn
304.62
ACM228402491
Copper zinc iron oxide
COPPER ZINC IRON OXIDE NANOPARTICLES / NANOPOWDER
CAS:66402-68-4
Formula: CuZnFe4O8
480.33
ACM66402684
Copper zinc ferrite
COPPER(+1)POTASSIUM CYANIDE
CAS:14264-30-3
Formula: C3CuK2N3
219.79
ACM14264303
DIPOTASSIUM TRICYANOCUPRATE(+1);COPPER(+1)POTASSIUM CYANIDE
COPPER(I) 2-THIOPHENECARBOXYLATE
CAS:68986-76-5
Formula: C5H3CuO2S;
190.683g/mol
ACM68986765
TR-022977; Copper(I) thiophene-2-carboxylate; COPPER (I) THIOPHENECARBOXYLATE; copper(I)thiophene carboxylate; Copper 2-thienylcarboxylate; SC-53004; AKOS015856654; (2-Thiophenecarboxylato)copper(I); RP08383; (THIOPHENE-2-CARBONYLOXY)COPPER;
COPPER(I) 3-METHYLSALICYLATE
CAS:326477-70-7
Formula: C8H7CuO3
214.69
ACM326477707
Copper(I) 3-methylsalicylate, 326477-70-7, SureCN1333592, CTK5I4906, AKOS015842203, Copper(I) 2-hydroxy-3-methylbenzoate, AG-C-78619, RP09300, AK109730, $l^{1}-copper(1+) ion 2-hydroxy-3-methylbenzoate
COPPER(I) ACETATE
CAS:598-54-9
Formula: Cu(CH3COO);C2H3CuO2;
122.59g/mol
ACM598549
acetate; AC1L2AY7; Acetic acid, copper(1+) salt (1:1); TR-020732; 67082-EP2374538A1; FT-0691520; Acetic Acid Copper(I) Salt; copper(1) acetate; AN-46279; CTK5B0602;
COPPER(I) BROMIDE
CAS:7787-70-4
Formula: CuBr;BrCu;
143.45g/mol
ACM7787704
Copper(I) bromide, 99.999% trace metals basis; Copper monobromide; copper-(1) bromide; Copper(I) bromide, 98%, extra pure; AKOS015833217; AC1L2NJJ; 7787-70-4; HSDB 270; copper- (I) bromide; I14-19753;
COPPER(I) BROMIDE DIMETHYL SULFIDE COMPLEX
CAS:54678-23-8
Formula: C2H6BrCuS;
205.58g/mol
ACM54678238
MFCD00043295; Bromo(dimethylsulfide) copper(I); copper (I) bromide dimethyl sulfide; CTK3J3229; Copper (I) bromide-dimethyl sulfide; AC1MC4I3; DTXSID80203133; ACN-050827; AKOS024437942; CuBr.Me2S;
COPPER(I) CHLORIDE
CAS:7758-89-6
Formula: ClCu
99
ACM7758896
Copper monochloride
COPPER(I) CHLORIDE
CAS:7758-89-6
Formula: ClCu
99
ACM7758896
Copper monochloride
COPPER(I) CHLORIDE - BIS(LITHIUM CHLORIDE) COMPLEX
Formula: CuCl 2LiCl
183.79
ACM-00013548
COPPER(I) CYANIDE DI(LITHIUM CHLORIDE) COMPLEX SOLUTION
Formula: CuCN 2LiCl
174.35
ACM-00013549
COPPER(I) CYANIDE-13C,15N
CAS:199450-10-7
Formula: CCuN
91.55
ACM199450107
199450-10-7
COPPER(I) CYANIDE-15N
CAS:204571-13-1
Formula: CuC(15-N)
90.56
ACM204571131
Copper(I) cyanide-15N, 423645_ALDRICH, 204571-13-1
COPPER(I) HEXAFLUORO-2,4-PENTANEDIONATE 1,5-CYCLOOCTADIENE COMPLEX
CAS:86233-74-1
Formula: C13H14CuF6O2;
379.789g/mol
ACM86233741
86233-74-1;MFCD00156517;Copper(I) hexafluoroacetylacetonate cyclooctadiene complex;Copper(i)hexafluoro-2,4-pentanedionate-cyclooctadiene complex;COPPER(I) HEXAFLUORO-2,4-PENTANEDIONATE-CYCLOOCTADIENE COMPLEX;
COPPER(I) IODIDE
CAS:7681-65-4
Formula: CuI
190.45
ACM7681654
Copper iodide (CuI);CuI;Hydro-giene;Marshite;COPPER(+1)IODIDE;COPPER IODIDE;COPPER(I) IODIDE;Ciras
COPPER(I) OXIDE
CAS:1317-39-1
Formula: Cu2O
143.09
ACM1317391
Copper(II) oxide, Cupric oxide, Copporal, Oxocopper, Copper Brown, Black copper oxide, Paramelaconite, Copacaps, Boliden Salt K-33, Copper oxygen(2-), Ketocopper
COPPER(I) OXIDE
CAS:1317-39-1
Formula: Cu2O
143.09
ACM1317391
Copper(II) oxide, Cupric oxide, Copporal, Oxocopper, Copper Brown, Black copper oxide, Paramelaconite, Copacaps, Boliden Salt K-33, Copper oxygen(2-), Ketocopper
COPPER(I) PHENYLACETYLIDE
CAS:13146-23-1
Formula: C8H5Cu
164.67
ACM13146231
COPPER(I) PHOSPHIDE
CAS:12019-57-7
Formula: Cu3P2
252.59
ACM12019577
CUPROUS PHOSPHIDE;CUPRIC PHOSPHIDE;COPPER PHOSPHIDE;tricopper phosphide;cuprousphosphide99.5%;Copper(II) phosphide;COPPER(I)PHOSPHIDE;Phosphinidynetricopper(I)
COPPER(I) THIOCYANATE
CAS:1111-67-7
Formula: CuSCN;CCuNS;
121.624g/mol
ACM1111677
1111-67-7; EPA Pesticide Chemical Code 025602; Z3649; SCHEMBL344362; DTXSID0034481; KS-00000FY7; AKOS015915156; Thiocyanic acid, copper(1+) salt; CCuNS; PW2155WE9H;
COPPER(I) THIOPHENOLATE
CAS:1192-40-1
Formula: C6H5CuS;
172.712g/mol
ACM1192401
Benzenethiol, copper(1+) salt; PNNJYDODNCALKD-UHFFFAOYSA-M; phenyl thio copper; Phenylthiocopper(I); phenylthiocopper; 1192-40-1; Copper(I) thiophenoxide;
COPPER(I) TRIFLUOROMETHANESULFONATE BENZENE COMPLEX
CAS:42152-46-5
Formula: CCuF3O3S1/2C6H6
251.67
ACM42152465
COPPER(I) TRIFLUOROMETHANESULFONATE TOLUENE COMPLEX
CAS:48209-28-5
Formula: C9H8Cu2F6O6S2;
517.359g/mol
ACM48209285
48209-28-5; Cuprous trifluoromethanesulfonate toluene complex; Copper(I) trifluoromethanesulfonate toluene complex; BP-12223; FT-0624054;
COPPER(I)SELENIDE
CAS:20405-64-5
Formula: Cu2Se
206.05
ACM20405645
copperselenide(cu2se);COPPER SELENIDE;COPPER(I) SELENIDE;CUPROUS SELENIDE;dicopper selenide;COPPER(I) SELENIDE, 99.95%;Copper(I)selenide,99.5%(metalsbasis);CUPROUS SELENIDE, 99.999%
COPPER(I)SELENIDE
CAS:20405-64-5
Formula: Cu2Se
206.05
ACM20405645
copperselenide(cu2se);COPPER SELENIDE;COPPER(I) SELENIDE;CUPROUS SELENIDE;dicopper selenide;COPPER(I) SELENIDE, 99.95%;Copper(I)selenide,99.5%(metalsbasis);CUPROUS SELENIDE, 99.999%
COPPER(I)SULFIDE
CAS:22205-45-4
Formula: Cu2S
159.16
ACM22205454
copper(i);coppersulfide(cu2s);cuprasulfide;cuproussulfide(cu2s);dicoppermonosulfide;dicoppersulfide;COPPER(I) SULFIDE;COPPER SULFIDE
COPPER(II) 2,3,9,10,16,17,23,24-OCTAFLUOROPHTHALOCYANINE&NBSP; (PURIFIED BY SUBLIMATION)
CAS:148651-60-9
Formula: C32H8CuF8N8
719.992746;g/mol
ACM148651609
C2427; Copper(II) 2,3,9,10,16,17,23,24-Octafluorophthalocyanine;
COPPER(II) 2-ETHYLHEXANOATE
CAS:149-11-1
Formula: C16H30CuO4
349.95
ACM149111
Cupric 2-ethylhexanoate;Cupric bis(2-ethylhexanoate)
COPPER(II) 3,5-DIISOPROPYLSALICYLATE HYDRATE
CAS:123334-28-1
Formula: C26H36CuO7;
524.113g/mol
ACM123334281-1
123334-28-1;Copper(II) 3,5-diisopropylsalicylate hydrate;Copper, tetrakis[m-[2-hydroxy-3,5-bis(1-methylethyl)benzoato-kO:kO']]di-, (Cu-Cu), hydrate (9CI);ACMC-20ecyq;CTK4B3473;AKOS025294213;RT-021900;
COPPER(II) ACETATE 1,2-BIS(DIPHENYLPHOSPHINO)ETHANE
580.05
ACM-00013550
COPPER(II) ACETATE MONOHYDRATE
CAS:6046-93-1
Formula: C4H8CuO5;
199.649g/mol
ACM6046931
ANW-33508; Cu(OAc)2 H2O; SC-81521; Copper(2+) acetate, monohydrate; NWFNSTOSIVLCJA-UHFFFAOYSA-L; DTXSID90209202; RTR-032126; ING0003985; AC1L4WMU; Copper(II) acetate monohydrate, ACS reagent;
Copper(II) Bis(trifluoromethanesulfonyl)imide
CAS:162715-14-2
Formula: C4CuF12N2O8S4;
623.817g/mol
ACM162715142
Copper(II) Bis(trifluoromethanesulfonyl)imide;Copper(II) bis((trifluoromethyl)sulfonyl)amide;Copper(II) Triflimide;Bis(trifluoromethanesulfonyl)imide Copper(II) Salt;Bis[bis(trifluoromethylsulfonyl)amino] copper(II);162715-14-2;
COPPER(II) BROMIDE
CAS:7789-45-9
Formula: CuBr2
223.35
ACM7789459
copperbromide(cubr2);copperdibromide;CUPRIC BROMIDE;COPPER(II) BROMIDE;COPPER BROMIDE;COPPER(+2)BROMIDE;Copperic bromide
;Copper(?) bromide
COPPER(II) CARBONATE BASIC
CAS:12069-69-1
Formula: CuCO3 Cu(OH)2
221.12
ACM12069691
Kop karb, Cheshunt compound, Basic copper carbonate, Basic cupric carbonate, Caswell No. 235, Copper carbonate, basic, Cupric carbonate, basic, Copper carbonate hydroxide, Dicopper dihydroxycarbonate, (Carbonato)dihydroxydicopper, Basic copper(II) carbona
COPPER(II) CHLORIDE DIHYDRATE
CAS:10125-13-0
Formula: Cl2CuH4O2;
170.476g/mol
ACM10125130
CUPRIC CHLORIDE, ACS; Copper(II) chloride dihydrate, 99+%, ACS reagent; Copper(II) chloride dihydrate, 99%, extra pure, powder; Copper (II) Chloride Dihydrate; Cupric chloride (TN); Coppertrace; dichlorocopper dihydrate; Copper(II) chloride dihydrate, 99+
COPPER(II) ETHYLACETOACETATE
CAS:14284-06-1
Formula: C12H18CuO6
321.81
ACM14284061
COPPER ETHYLACETOACETATE;COPPER(II) ETHYLACETOACETATE;CUPRIC ETHYLACETOACETATE;ETHYL ACETOACETATE, COPPER DERIVATIVE;bis(ethylacetylacetate)copper;Copper(Ii)Ethylacetoacetate,>98%;Copper(II)ethylacetoacetate,99%;Acetoacetic acid, ethyl ester, copper compl
COPPER(II) HYDROGEN PHOSPHATE
CAS:13587-24-1
Formula: Cu.H3O4P
159.525301
ACM13587241
Copper hydrogen phosphate, EINECS 237-020-6, Copper Hydroxy-dioxido-oxo-phosphorane, CID11435098, 13587-24-1
COPPER(II) NITRATE HEMI(PENTAHYDRATE)
CAS:19004-19-4
Formula: Cu(NO3)2 2.5H2O
232.59
ACM19004194
CUPRIC NITRATE, 2.5-HYDRATE;CUPRIC NITRATE HEMIPENTAHYDRATE;CUPRIC NITRATE, HYDRATE;COPPER (II) NITRATE;COPPER(II) NITRATE-2,5-HYDRATE;COPPER(II) NITRATE HEMIPENTAHYDRATE;COPPER (II) NITRATE, HYDRATE;COPPER NITRATE, HYDRATE
COPPER(II) NITRATE HEMI(PENTAHYDRATE)
CAS:19004-19-4
Formula: Cu(NO3)2 2.5H2O
232.59
ACM19004194
CUPRIC NITRATE, 2.5-HYDRATE;CUPRIC NITRATE HEMIPENTAHYDRATE;CUPRIC NITRATE, HYDRATE;COPPER (II) NITRATE;COPPER(II) NITRATE-2,5-HYDRATE;COPPER(II) NITRATE HEMIPENTAHYDRATE;COPPER (II) NITRATE, HYDRATE;COPPER NITRATE, HYDRATE
COPPER(II) OXIDE
CAS:1317-38-0
Formula: CuO;CuO;
79.545g/mol
ACM1317380
Copper oxide (CuO); Copper Brown; AKOS015950660; Copper(II) oxide, 97%; Osmose K-33-C Wood Preservative; Copper(II) oxide (99.995%-Cu) PURATREM; EPA Pesticide Chemical Code 042401; Copper monooxide; Osmose P-50 Wood Preservative; Copporal;
COPPER(II) POTASSIUM CHLORIDE
CAS:10085-76-4
Formula: K2CuCl4.2H2O
319.59
ACM10085764
POTASSIUM COPPER(II) CHLORIDE DIHYDRATE;POTASSIUM DIAQUATETRACHLOROCUPRATE(II);POTASSIUM TETRACHLOROCUPURATE(II) DIHYDRATE;COPPER(II) POTASSIUM CHLORIDE DIHYDRATE;Cl4CuH4K2O2;potassium tetrachlorocupurate(?)dihydrate
COPPER(II) PYROPHOSPHATE
CAS:10102-90-6
Formula: Cu2P2O7
301.03
ACM10102906
Cupricpyrophosphate,trihydra;pyrophosphoricacid,coppersalt;COPPER (II) PYROPHOSPHATE;COPPER(II) DIPHOSPHATE TETRAHYDRATE;COPPER PYROPHOSPHATE;diphosphoric acid copper salt;CUPRIC PYROPHOSPHATE;CUPRIC PYROPHOSPHATE DIH2O
COPPER(II) SELENATE 5-HYDRATE
CAS:10031-45-5
Formula: Cu. H2 O4 Se . 5 H2 O
206.5
ACM10031455
Copper(?)selenate;CUPRIC SELENATE;COPPER(II) SELENATE;Copper(?) selenate pentahydrate;COPPER(II)SENENATEPENTAHYDRATE
COPPER(II) SULFATE 1-HYDRATE
CAS:10257-54-2
Formula: CuSO4.H2O
177.62
ACM10257542
COPPER(II) SULFATE HYDRATE 98;Copper sulfate hydrate;CUPRICSULFATE,MONOHYDRATE,PURIFIED;Copper sulfate monohydrate
COPPER(II) SULFATE PENTAHYDRATE
CAS:7758-99-8
Formula: CuSO4.5H2O;CuSO45H2O;CuH10O9S;
249.677g/mol
ACM7758998
Cupric sulfate (USP); JZCCFEFSEZPSOG-UHFFFAOYSA-L; D03613; Copper (II) Sulfate pentahydrate; Copper(II) sulfate pentahydrate (99.999%-Cu) PURATREM; Copper(II) sulfate pentahydrate, Trace metals grade, 99.995%; Coppersulfatepentahydrate; copper(II) sulphat
COPPER(II) SULFATE SOLUTION
CAS:7758-98-7
Formula: CuSO4;CuSO4;CuO4S;
159.602g/mol
ACM7758987
Copper(II) sulfate, 98%, pure, anhydrous; ARUVKPQLZAKDPS-UHFFFAOYSA-L; BP-20356; K358; Bluestone (pentahydrate); Copper (11) sulfate; Blue copper (VAN); Copper (II) sulfate (1:1); FT-0624048; KUW2Q3U1VV;
COPPER(II) TARTRATE HYDRATE
CAS:946843-80-7
Formula: C4H6CuO7;
229.631g/mol
ACM946843807
Cupric tartrate hydrate;Tartaric acid cupric salt;946843-80-7;DTXSID50746608;Copper(2+) (2R,3R)-2,3-dihydroxybutanedioate--water (1/1/1);Copper(II) tartrate hydrate, >=95.0% (calc. on dry substance, RT);
COPPER(II) TERT-BUTYLACETOACETATE
CAS:23670-45-3
Formula: C16H28CuO6;
379.94g/mol
ACM23670453-1
23670-45-3;Copper(II) tert-butylacetoacetate;Bis(t-butylacetoacetato)copper(II);MFCD12545949;Bis(tert-butylacetoacetato)copper(II);Copper(II) tert-butylacetoacetate, 97%;
COPPER(II) TETRAFLUOROBORATE (CA. 45% IN WATER)
CAS:38465-60-0
Formula: B2CuF8;
237.153g/mol
ACM38465600
Copper(II) tetrafluoroborate(45% in H2O); ST2412746; Copper tetrafluoroborate; 14735-84-3; EINECS 253-959-4; Copper(II) Tetrafluoroborate; Borate(1-), tetrafluoro-, copper(2+) (2:1); FT-0659273; Cupric fluoroborate; FT-0624059;
COPPER(II) TETRAFLUOROBORATE 6-HYDRATE
CAS:72259-10-0
Formula: Cu(BF4)2.6H2O
345.25
ACM72259100
COPPER(II) TETRAFLUOROBORATE, APPROX 45% IN WATER
237.16
ACM-00013542
COPPER(II) TETRAKIS(4-CUMYLPHENOXY)-PHTH ALOCYANINE
CAS:91083-47-5
Formula: C92H72CuN8O4
1417.15
ACM91083475
COPPER(II) TRIFLUOROMETHANESULFONATE
CAS:34946-82-2
Formula: C2CuF6O6S2;
361.672g/mol
ACM34946822
copper(2+) ion ditrifluoromethanesulfonate; TD8155; X7227; ANW-28028; Copper(II) triflate; AC1MC2EB; ST24046367; AK111530; C2CuF6O6S2; ACT09577;
COPPER(II) TRIFLUOROMETHANESULFONIMIDE HYDRATE
CAS:1334406-76-6
623.84 (anhydrous basis)
ACM1334406766
COPPER(II)1,4,8,11,15,18,22,25-OCTA-BUTOXYPHTHALOCYANINE
CAS:107227-88-3
Formula: C64H80CuN8O8
1152.93
ACM107227883
COPPER(II) 1,4,8,11,15,18,22,25-OCTA- BUTOXYPHTHALOCYANINE;copper(II) octabutoxy-29H,31H-phthalocyanine;Copper(II) 1,4,8,11,15,18,22,25-octabutoxy-29H,31H-phthalocyanine Dye content 95 %
COPPER(II)2 3 9 10 16 17 23 24-OCTAKIS&
CAS:119495-09-9
Formula: C96H144CuN8O8
1601.79
ACM119495099
COPPER(II) 2 3 9 10 16 17 23 24-OCTAKIS&;copper(ii) 2,3,9,10,16,17,23,24-octakis-(octyloxy;Copper(II) 2,3,9,10,16,17,23,24-octakis(octyloxy)-29H,31H-phthalocyanine Dye content 95 %
COPPER(II)3,5-DIISOPROPYLSALICYLATE HYDRATE
CAS:123334-28-1
Formula: C26H34CuO6•xH2O
506.09 (anhydrous basis)
ACM123334281
2-Hydroxy-3,5-bis(1-methylethyl)benzoic acid, copper(II) complex, 123334-28-1
COPPER(II)4 4 4 4-TETRAAZA-29H 3&
CAS:15275-52-2
Formula: C28H12CuN12
580.033
ACM15275522
COPPER(II) 4 4 4 4-TETRAAZA-29H 3&;copper(ii) 4,4,4,4-tetraaza-29H,31H-phthalo;Copper(II) 4,4,4,4-tetraaza-29H,31H-phthalocyanine
COPPER(II)5,9,14,18,23,27,32,36-OCTABUTOXY-2,3-NAPHTHALOCYANINE
CAS:155773-67-4
Formula: C80H88CuN8O8
1353.15
ACM155773674
COPPER(II) 5,9,14,18,23,27,32,36-OCTABUTOXY-2,3-NAPHTHALOCYANINE;5,9,14,18,23,27,32,36-OCTABUTOXY-2,3-NAPHTHALOCYANINE COPPER(II) SALT;copper (ii) 5,9,14,18,23,27,32,36-*octabutoxy-2,3;cu(ii)5,9,14,18,23,27,32,36-octabutoxy-2,3-naphthalocyanine;CU(II)5,9,
COPPER(II)ACETATE MONOHYDRATE
CAS:66923-66-8
Formula: C4H8CuO5
199.65
ACM66923668
COPPER (II) ACETATE, HYDROUS;COPPER(II) ACETATE HYDRATE;COPPER(II) ACETATE-1-HYDRATE;COPPER(+2)ACETATE MONOHYDRATE;COPPER ACETATE MONOHYDRATE;COPPER ACETATE;CUPRIC ACETATE H2O;CUPRIC ACETATE 1-HYDRATE
COPPER(II)BENZOYLACETONATE
CAS:14128-84-8
Formula: C20H18CuO4
385.9
ACM14128848
CUPRIC BENZOYLACETONATE;CUPRIC PHENYLBUTANEDIONATE;COPPER(II) BENZOYLACETONATE;COPPER BENZOYLACETONATE;BIS(1-PHENYL-1,3-BUTANEDIONO)COPPER;bis(1-phenyl-1,3-butanedionato-o,o')-coppe;Copper, bis(1-phenyl-1,3-butanedionato-O,O)-;Copper(II)benzylacetonate,NL
COPPER(II)CHLORATE,TETRAHYDRATE
CAS:10294-45-8
ACM10294458
COPPER(II)ETHOXIDE
CAS:2850-65-9
Formula: C4H10CuO2
153.67
ACM2850659
COPPER(II) ETHOXIDE
COPPER(II)FLUORIDEHYDROXIDE,99.999%(METALSBASIS)
CAS:13867-72-6
Formula: Cu(OH)F
99.55
ACM13867726
Copper fluoride hydroxide, EINECS 237-614-5, CID3014793, 13867-72-6
COPPER(II)FORMATE HYDRATE
CAS:133386-04-6
Formula: C2H4CuO5
171.6
ACM133386046
COPPER(II)HEXAFLUOROACETYLACETONATE HYDRATE,98
CAS:155640-85-0
Formula: C10H4CuF12O5
495.6625984
ACM155640850
COPPER(II) HEXAFLUOROACETYLACETONATE HYDRATE, 98;Copper(II) hexafluoro-2,4-pentanedionate hydrate, 99.99% (metals basis);Copper(II) hexafluoro-2,4-pentanedionate hydrate,98% Cu(CF3COCHCOCF3)2xH2O;(SP-4-1)-Bis(1,1,1,5,5,5-hexafluoro-2,4-pentanedionato-O,O)
COPPER(II)HYDROXIDE
CAS:20427-59-2
Formula: CuH2O2
97.56068
ACM20427592
COPPER(II)IONOPHORE I
CAS:125769-67-7
Formula: C26H44N2S4
512.9
ACM125769677
Copper(II) ionophore I, o-XBDiBDTC, o-Xylylenebis(N,N-diisobutyldithiocarbamate), 125769-67-7, AC1NPZXW, 61193_FLUKA, CTK8E7237, [2-[bis(2-methylpropyl)carbamothioylsulfanylmethyl]phenyl]methyl N,N-bis(2-methylpropyl)carbamodithioate
COPPER(II)METHOXIDE
CAS:76890-98-7
Formula: C2H6CuO2
125.61
ACM76890987
COPPER(II) METHOXIDE;Copper (II) methoxide, 98% (typical);Copper(II)methoxide,typically98%(metalsbasis);COPPER METHOXIDE;Copper methoxide/ 99.9%
COPPER(II)METHOXIDE
CAS:76890-98-7
Formula: C2H6CuO2
125.61
ACM76890987
COPPER(II) METHOXIDE;Copper (II) methoxide, 98% (typical);Copper(II)methoxide,typically98%(metalsbasis);COPPER METHOXIDE;Copper methoxide/ 99.9%
COPPER(II)METHOXIDE97
CAS:1184-54-9
Formula: Cu(OCH3)2
125.61
ACM1184549
COPPER(II) METHOXIDE97;Cupric methoxide
COPPER(II)METHOXIDE97
CAS:1184-54-9
Formula: Cu(OCH3)2
125.61
ACM1184549
COPPER(II) METHOXIDE97;Cupric methoxide
COPPER(II)NAPHTHENATE
CAS:1338-02-9
Formula: (C11H7O2)2Cu
405.90
ACM1338029
CNC;CUNAPSOL(R);CUPRIC NAPHTHENATE;CUPRINOL(R);CURAP 20(R);COPPER NAPHTHENATE;COPPER NAPHTHENATES;COPPER (II) NAPHTHENATE
COPPER(II)NEODECANOATE
CAS:50315-14-5
Formula: C20H38CuO4
406.06
ACM50315145
Copperneodecanoate;Neodecanoicacid,coppersalt;COPPER (II) NEODECANOATE;Copperneodecanoatesuperconductorgradecaintoluene;Copper(II)neodecanoatesuperconductorgrade,60%intoluene(6-12%cu);COPPER(II) NEODECANOATE, SUPERCONDUCTOR GRADE: CA. 60% IN TOLUENE (6-1
COPPER(II)NIOBATE99
CAS:12273-00-6
Formula: Cu(NbO3)2
345.36
ACM12273006
COPPER(II) NIOBATE99
COPPER(II)NITRATE HYDRATE
CAS:13778-31-9
Formula: CuH2N2O7
205.57
ACM13778319
COPPER (II) NITRATE;COPPER(II) NITRATE HYDRATE;CUPRIC NITRATE HYDRATE;CUPRIC NITRATE HYDRATED;copper(ii) nitrate hydrate, puratronic;Copper(II) nitrate hydrate, Puratronic(R), 99.999% (metals basis);Nitric acid copper(2+) salt hydrate;Copper(II) nitrate h
COPPER(II)PERCHLORATE HEXAHYDRATE
CAS:10294-46-9
Formula: Cl2CuH12O14
370.54
ACM10294469
CUPRIC PERCHLORATE HEXAHYDRATE;CUPRIC PERCHLORATE, HYDRATED;COPPER (II) PERCHLORATE;COPPER(II) PERCHLORATE HEXAHYDRATE;COPPER(+2)PERCHLORATE HEXAHYDRATE;Copper(II)perchlorate hydrate;CUPRIC PERCHLORATE, HYDRATED REAGENT;Copper(II)perchloratehexahydrate,98
COPPER(II)PHTHALOCYANINE-3 4 4 4&
CAS:123439-80-5
Formula: C32H12CuN8O12S4.4Na
984.261
ACM123439805
COPPER(II) PHTHALOCYANINE-3 4 4 4&;copper(ii) phthalocyanine-3,4,4,4-tetrasulf;COPPER(II) PHTHALOCYANINE-3,4,4,4- TETRASULFONIC ACID, TETRASODIUM SALT;Copper phthalocyanine-3,4`,``,4```-tetrasulfonic acid tetrasodiuM salt;Copper phthalocyanine-3,4,4",4"-t
COPPER(II)PHTHALOCYANINE-3 4 4 4&
CAS:123439-80-5
Formula: C32H12CuN8O12S4.4Na
984.261
ACM123439805
COPPER(II) PHTHALOCYANINE-3 4 4 4&;copper(ii) phthalocyanine-3,4,4,4-tetrasulf;COPPER(II) PHTHALOCYANINE-3,4,4,4- TETRASULFONIC ACID, TETRASODIUM SALT;Copper phthalocyanine-3,4`,``,4```-tetrasulfonic acid tetrasodiuM salt;Copper phthalocyanine-3,4,4",4"-t
COPPER(II)STEARATE
CAS:660-60-6
Formula: C36H70CuO4
630.48
ACM660606
Octadecanoic acid copper(2+) salt;copperdistearate,pure;Copper distearate;COPPER STEARATE;COPPER(II) STEARATE;CUPRIC STEARATE;STEARICACID,COPPER(2+)SALT;Bis(stearic acid)copper(II) salt
COPPER(II)SULFATEHYDRATE,PURATRONIC®,99.999%(METALSBASIS)
CAS:23254-43-5
Formula: CuSO4xH2O
159.60(anhy)
ACM23254435
Copper(II) sulfate hydrate,Puratronic(R),99.9 (metals basis); Copper(II) sulfate hydrate,Puratronic,99.9 (metals basis); COPPER(II) SULFATE HYDRATE;
COPPER(II)SULFIDE
CAS:1317-40-4
Formula: CuS
ACM1317404
COPPER(II)TETRAFLUOROBORATEHYDRATE
CAS:207121-39-9
Formula: Cu(BF4)2xH2O
255.17
ACM207121399
COPPER(II)TETRAFLUOROBORATEHYDRATE
CAS:207121-39-9
Formula: Cu(BF4)2xH2O
255.17
ACM207121399
COPPER(II)TITANATE
CAS:12019-08-8
Formula: CuO3Ti
159.42
ACM12019088
COPPER(II)TITANATE;COPPER TITANATE;copper titanium trioxide
COPPER(II)TRIFLUOROACETATE
CAS:123333-88-0
Formula: C4CuF6O4
289.58
ACM123333880
COPPER (II) TRIFLUOROACETATE;Coppertrifluoroacetatehydrate;2,2,2-Trifluoroacetic acid copper(2+) salt hydrate
COPPER(II)TRIFLUOROACETYLACETONATE
CAS:14324-82-4
Formula: C10H8CuF6O4
369.7
ACM14324824
TRIFLUOROACETYL ACETONE, CU(II);TRIFLUOROACETYLACETONO COPPER(II) SALT;Copper 1,1,1-trifluoroacetylacetonate;Copper bis(1,1,1-trifluoro-2,4-pentanedionate);Copper bis(trifluoroacetylacetonate);Copper, bis(1,1,1-trifluoro-2,4-pentanedionato)-;Cupric 1,1,1-
COPPER, [29H,31H-PHTHALOCYANINATO(2-)-N29,N30,N31,N32]-, AMINOSULFONYL SULFO DERIVS., SODIUM SALTS
CAS:90295-11-7
ACM90295117
Copper, [29H,31H-phthalocyaninato(2-)-N29,N30,N31,N32]-, aminosulfonyl sulfo derivs., sodium salts;Copper, 29H,31H-phthalocyaninato(2-)-.kappa.N29,.kappa.N30,.kappa.N31,.kappa.N32-, aminosulfonyl sulfo derivs., sodium salts;Copper phthalocyanine, sulfamo
COPPER,(TERT-DECANOATO-O)(2-ETHYLHEXANOATO-O)-(9CI)
CAS:100231-69-4
Formula: C18H34CuO4
ACM100231694
COPPER,BIS[2-(HYDROXY-KO)PROPANOATO-KO]-
CAS:16039-52-4
Formula: C6H10CuO6
152.6155
ACM16039524
copper dilactate;Kupfer(II)-laktat;Lacticacidcopper(II)salt;COPPER LACTATE;Bis[(S)-2-hydroxypropionic acid] copper(II) salt;Dilactic acid copper(II) salt
COPPER-2(3)-9(10)-16(17)-23(24)-TETRAMETHYL-2(3)-9(10)-16(17)-23-(24)-TETRA-AZONIAPHTHALOEYANINE TETRAKIS(METHANOSULFATE)
CAS:81207-55-8
Formula: C40H40CuN8O12S4
1016.6
ACM81207558
CUPROMERONIC BLUE;COPPER-2(3)-9(10)-16(17)-23(24)-TETRAMETHYL-2(3)-9(10)-16(17)-23-(24)-TETRA-AZONIAPHTHALOEYANINE TETRAKIS (METHANOSULFATE);Copper-2(3)-9(10)-16(17)-23(24)-tetramethyl-2(3)-9(10)-16(17)-23-(24)-tetra-azoniaphthaloeyaninetetrakis(methanosu
COPPER-TIN ALLOY NANOPARTICLES
CAS:158113-12-3
Formula: CuSn
182.26
ACM158113123
COPPER-TIN ALLOY;COPPER METAL ALLOY-COPPER TIN;BRONZE;COPPER-TIN ALLOY, CA. 90/10, SPHERICAL P OWDER,-200 MESH;Bronze powder, -100 mesh, 99.0% (metals basis);Bronze,Sn5Cu84;Copper-tin alloy,Bronze, Sn5Cu84;Copper-tin alloy spherical powder, -200 Mesh
COPPER-TIN ALLOY NANOPARTICLES
CAS:158113-12-3
Formula: CuSn
182.26
ACM158113123
COPPER-TIN ALLOY;COPPER METAL ALLOY-COPPER TIN;BRONZE;COPPER-TIN ALLOY, CA. 90/10, SPHERICAL P OWDER,-200 MESH;Bronze powder, -100 mesh, 99.0% (metals basis);Bronze,Sn5Cu84;Copper-tin alloy,Bronze, Sn5Cu84;Copper-tin alloy spherical powder, -200 Mesh
COPPER-ZINC ALLOY NANOPRISMS
CAS:86376-49-0
Formula: CuZn
126.86
ACM86376490
COPPERHYDROSELENITEMONOHYDRATE
CAS:10031-39-7
ACM10031397
COPROPORPHYRIN I DIHYDROCHLORIDE
CAS:69477-27-6
Formula: C36H40Cl2N4O8
727.63
ACM69477276
21H,23H-Porphine-2,7,12,17-tetrapropanoicacid, 3,8,13,18-tetramethyl-, hydrochloride (1:2); Coproporphyrin I dihydrochloride; MFCD00013469; CTK2F6131; 69477-27-6; Coproporphyrin I dihydrochloride (synthetic);
COPROPORPHYRIN III DIHYDROCHLORIDE
CAS:14643-66-4
Formula: C36H40Cl2N4O8
654.7089
ACM14643664
COPROPORPHYRIN III DIHYDROCHLORIDE;3,8,13,17-TETRAMETHYL-21H,23H-PORPHINE-2,7,12, 18-TETRAPROPIONIC ACID DIHYDROCHLORIDE;coproporphyriniii2HCl;Coproporphyrin ? dihydrochloride;3,8,13,17-tetramethylporphyrin-2,7,12,18-tetrapropanoic acid;Coproporphyrin d
COPROPORPHYRIN III TETRAETHYL ESTER)
CAS:77934-49-7
ACM77934497
COPROSTAN-3-OL
CAS:360-68-9
Formula: C27H48O
388.67
ACM360689
Koprosterin; Cholestan-3-ol; 5beta-cholestanol; COPROSTEROL; COPROSTAN-3B-OL; COPROSTAN-3-OL; Stercorin; Koprosterol; Zymostanol;
CORALGIL
CAS:69-14-7
Formula: C30H48N2O2
0
ACM69147
Coralgil;Diethylaminoethoxyhexestrol hydrochloride;2,2-[3,4-Hexanediylbis(4,1-phenyleneoxy)]-bis(N,N-diethylethanamine)
CORAZONIN
CAS:122929-08-2
Formula: C62H84N18O18
1369.44
ACM122929082
CORDYCEPS MILITARIS EXTRACT
ACM-00003481
CORDYCEPS SINENSIS FRUITING BODY
CAS:73-03-0
Formula: C10H13N5O3
251.24
ACM73030
Cordyceps sinensis (Berk.) Sacc
CORDYCEPS SINENSIS FRUITING BODY
CAS:73-03-0
Formula: C10H13N5O3
251.24
ACM73030
Cordyceps sinensis (Berk.) Sacc
COREY LACTONE DIOL
CAS:32233-40-2
Formula: C8H12O4
172.18
ACM32233402
COREY LACTONE THP
CAS:69222-61-3
Formula: C13H20O5
256.29
ACM69222613
Corey lactone THP;(3aR,4S,5R,6aS)-Hexahydro-4-(hydroxymethyl)-5-[(tetrahydro-2H-pyran-2-yl)oxy]-2H-cyclopenta[b]furan-2-one
CORIANDER EXTRACT
CAS:84775-50-8
ACM84775508
CORIANDER EXTRACT
CAS:84775-50-8
ACM84775508
CORN OLIGOPEPTIDE
=1000
ACM-00003377
CORN PROTEIN HYDROLYZATE
CAS:100209-41-4
ACM100209414
CORNUSIDE
CAS:131189-57-6
Formula: C34H50O20
542.49
ACM131189576
cornuside;Cornuside I;Methyl (2R,3S,4R)-3-ethenyl-4-[2-(3,4,5-trihydroxybenzoyl)oxyethyl]-2-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3,4-dihydro-2H-pyran-5-carboxylate;(2S)-3a-Ethenyl-2-(-D-glucopyranosyloxy)-3,4-dihydro-4a-[2-(
CORONENE
CAS:191-07-1
Formula: C24H12
300.35
ACM191071
Dibenzo(ghi,pqr)perylene;dibenzo[ghi,pqr]perylene;CORONENE;HEXABENZOBENZENE;Coronene (purity);45070, Coronene (purity);CORONENE, SUBLIMED, 99%;Coronene (refined product of C0386)
CORONENE
ACM-00000337
CORONENE,1-METHYL-
CAS:13119-86-3
Formula: C25H14
314.3787
ACM13119863
1-METHYLCORONENE
CORTEXOLONE
CAS:152-58-9
Formula: C21H30O4
346.46
ACM152589
11-Deoxycortisol; 11-deoxy-17-hydroxy-corticosterone; CORTEXOLONE; 11-Deoxy-17-hydroxycorticosterone; Reichsteins substance S; 17,21-Dihydroxy-pregn-4-ene-3,20-dione; 17a,21-Dihydroxy-4-pregnene-3,20-dione; CORTODOXONE; 11-DESOXYCORTISOL; Cortexolone; skf
CORTICOSTERONE
CAS:50-22-6
Formula: C21H30O4
346.46
ACM50226
CORTICOSTERONE; Corticosterone; (8S,9S,10R,11S,13S,14S,17S)-11-hydroxy-17-(2-hydroxyacetyl)-10,13-dimethyl-1,2,6,7,8,9,11,12,14,15,16,17-dodecahydrocyclopenta[a]phenanthren-3-one;
CORTICOSTERONE 21-ACETATE
CAS:1173-26-8
Formula: C23H32O5
388.5
ACM1173268
11,21-Dihydroxy-4-pregnene-3,20-dione 21-Acetate; [2-[(8S,9S,10R,11S,13S,14S,17S)-11-hydroxy-10,13-dimethyl-3-oxo-1,2,6,7,8,9,11,12,14,15,16,17-dodecahydrocyclopenta[a]phenanthren-17-yl]-2-oxoethyl] acetate;
CORTICOSTERONE 21-SULFATE POTASSIUM
CAS:100775-23-3
Formula: C21H29KO7S
464.61406
ACM100775233
CORTICOSTERONE 21-SULFATE POTASSIUM;11,21-Dihydroxy-4-pregnene-3,20-dione 21-sulfate, 4-Pregnene-11,21-diol-3,20-dione 21-sulfate;Corticosterone 21-sulfate potassium salt
CORTICOSTERONE-21-HEMISUCCINATE
CAS:10215-77-7
Formula: C25H34O7
446.54
ACM10215777
CORTICOTROPIN-RELEASINGFACTOR(HUMAN),N-L-TYROSYL-(9CI)
CAS:100513-58-4
Formula: C217H353N61O65S2
4920.62
ACM100513584
CORTISONE
CAS:53-06-5
Formula: C21H28O5
360.44
ACM53065
17,21-Dihydroxy-4-pregnene-3,11,20-trione;17,21-Dihydroxypregn-4-ene-3,11,20-trione;20-trione,17,21-dihydroxy-pregn-4-ene-11;Adrenalex;Adreson;Andreson;Corlin;Cortadren
CORTISONE
CAS:53-06-5
Formula: C21H28O5
360.44
ACM53065
17,21-Dihydroxy-4-pregnene-3,11,20-trione;17,21-Dihydroxypregn-4-ene-3,11,20-trione;20-trione,17,21-dihydroxy-pregn-4-ene-11;Adrenalex;Adreson;Andreson;Corlin;Cortadren
CORTISONE ACETATE
CAS:50-04-4
Formula: C23H30O6
402.48
ACM50044
4-Pregnene-17a,21-diol-3,11,20-trione 21-acetate; 21-Acetoxy-4-pregnen-17a-ol-3,11,20-trione; [2-[(8S,9S,10R,13S,14S,17R)-17-hydroxy-10,13-dimethyl-3,11-dioxo-1,2,6,7,8,9,12,14,15,16-decahydrocyclopenta[a]phenanthren-17-yl]-2-oxoethyl] acetate; 17a,21-Dih
CORTIVAZOL
CAS:1110-40-3
Formula: C32H38N2O5
530.661
ACM1110403
cortivazol ;Altim;Diaster;Dilaster;Idaltin;NSC-80998;(11,16a)-21-(Acetyloxy)-11,17-dihydroxy-6,16-diMethyl-2-phenyl-2H-pregna-2,4,6-trieno[3,2-c]pyrazol-20-one;11,17a,21-Trihydroxy-6,16a-diMethyl-2-phenylpregna-
2,4,6-trieno[3,2-c]pyrazol-20-one 21-
CORYLIN
CAS:53947-92-5
Formula: C20H16O4
0
ACM53947925
Corylin
COSTIC ACID
CAS:3650-43-9
Formula: C15H22O2
234.33398
ACM3650439
(2R,8a)-Decahydro-4aa-methyl-a,8-bis(methylene)-2a-naphthaleneacetic acid;beta-Costic acid;(2R,4aR,8aS)-Decahydro-4a-methyl-alpha,8-bis(methylene)-2-naphthaleneacetic acid;Costus acid
COTININE-N-ALPHA-D-GLUCURONIDE
CAS:139427-57-9
Formula: C16H20N2O7
355.36
ACM139427579
COTRIMOXAZOLE
CAS:8064-90-2
Formula: C14H18N4O35C10H11N3O3S
1556.71
ACM8064902
SMZ/TMP; Trimethoprim-Sulfamethoxazole Combination; Septrim; Sulfamethoxazole/Trimethoprim; TRIMETHOPRIM/SULPHAMETHOXAZOLE; Chemitrim;
COTTONSEED FLOUR
CAS:68308-87-2
ACM68308872
COUCH GRASS EXTRACT
ACM-00003457
COUMARIN 153
CAS:53518-18-6
Formula: C16H14F3NO2
309.28
ACM53518186
COUMARIN 339
CAS:62669-73-2
Formula: C13H13NO2
215.24782
ACM62669732
4-methyl-6,7,8,9-tetrahydro-2h-pyrano[3,2-g]quinolin-2-one;coumarin 339;2-g]quinolin-2-one,6,7,8,9-tetrahydro-4-methyl-2h-pyrano[;COUMARIN 339, LASER GRADE, 99
COUMARIN 6
CAS:38215-36-0
ACM38215360-2
COUMARIN 7
CAS:27425-55-4
Formula: C20H19N3O2
333.40
ACM27425554
3-(1H-benzo[d]imidazol-2-yl)-7-(diethylamino)-2H-chromen-2-one
COUMARIN 7
CAS:27425-55-4
Formula: C20H19N3O2
333.40
ACM27425554
3-(1H-benzo[d]imidazol-2-yl)-7-(diethylamino)-2H-chromen-2-one
COUMARIN-4-ACETIC ACID 7-BETA-D-GALACTOPYRANOSIDE
CAS:127615-74-1
Formula: C17H18O10
382.32
ACM127615741
COUMARIN-6-SULFONYL CHLORIDE
CAS:10543-42-7
Formula: C9H5ClO4S
244.65
ACM10543427
2-Oxo-2H-1-benzopyran-6-sulfonyl chloride , 6-CS-Cl , C6SCl
COUPLING AGENT
ACM-00013879
COUPLING AGENT NBC-1
ACM-00013876
CP 100356 HYDROCHLORIDE
CAS:142716-85-6
Formula: C31H36N4O6.HCl
C31H36N4O6.HCl
ACM142716856
CP 339818 HYDROCHLORIDE
CAS:185855-91-8
Formula: C21H24N2.HCl
340.8896
ACM185855918
CP 376395 HYDROCHLORIDE
CAS:175140-00-8
Formula: C21H30N2HCl
C21H30N2.HCl
ACM175140008
CP 376395 HYDROCHLORIDE, SureCN3103253, CTK8E7534, 175140-00-8
CP 465022 HYDROCHLORIDE
CAS:199655-36-2
Formula: C26H24ClFN4OHCl
C26H24ClFN4O
ACM199655362
CP 809101 HYDROCHLORIDE
CAS:479683-64-2
Formula: C15H17N4OClHCl
C15H17N4OCl.HCl
ACM479683642
CP 93129 DIHYDROCHLORIDE
CAS:127792-75-0
Formula: C12H15Cl2N3O
288.17
ACM127792750
CP 94253 HYDROCHLORIDE
CAS:131084-35-0
Formula: C15H19N3O.HCl
293.79
ACM131084350
CP-100356 MONOHYDROCHLORIDE
CAS:142715-48-8
Formula: C31H37ClN4O6
597.10
ACM142715488
CP-100356 Hydrochloride, CP-100356 monohydrochloride, CCG-221480, 142715-48-8, 4-(3,4-Dihydro-6,7-dimethoxy-2(1H)-isoquinolinyl)-N-[2-(3,4-dimethoxyphenyl)ethyl]-6,7-dimethoxy-2-quinazolinamine monohydrochloride
CP-154526 HYDROCHLORIDE
CAS:257639-98-8
400.99
ACM257639988
CP-226269
CAS:220941-93-5
Formula: C18H19FN4
310.37
ACM220941935
HMS3263O08; 5-fluoro-2-(4-pyridin-2-yl-piperazin-1-ylmethyl)-1H-indole; 5-fluoro-2-[[4-(2-pyridinyl)-1-piperazinyl]methyl]-1H-indole; 5-Fluoro-2-{[4-(2-pyridinyl)-1-piperazinyl]methyl}-1H-indole;
CP-24879 HYDROCHLORIDE
CAS:10141-51-2
Formula: C11H18ClNO
215.72
ACM10141512
CP-31398 DIHYDROCHLORIDE HYDRATE
CAS:1217195-61-3
Formula: C22H26N4O
362.46
ACM1217195613
N'-[2-[2-(4-Methoxyphenyl)ethenyl]-4-quinazolinyl]-N,N-dimethyl-1,3-propanediamine dihydrochloride hydrate
CP-339818
CAS:478341-55-8
Formula: C21H24N2•HCl
340.89
ACM478341558
CP-53631
CAS:79836-56-9
Formula: C17H19BrClN
352.70
ACM79836569
CHEMBL1743855, SureCN10991066, CP-53631, (1R,4S)-rel-4-(4-Bromophenyl)-1,2,3,4-tetrahydro-N-methyl-1-naphthalenamine Hydrochloride, trans-4-(4-Bromophenyl)-1,2,3,4-tetrahydro-N-methyl-1-naphthalenamine Hydrochloride, 79836-56-9, trans-( inverted exclamati
CP-66713
CAS:91896-57-0
295.73
ACM91896570
CP-802079 HYDROCHLORIDE HYDRATE
CAS:736175-49-8
Formula: C22H21ClN2O4S
444.93 (anhydrous free base basis)
ACM736175498
CP-802079 HYDROCHLORIDE HYDRATE;
CP-868388
CAS:702681-67-2
439.54
ACM702681672
CP-93129 DIHYDROCHLORIDE HYDRATE
CAS:879089-64-2
Formula: C12H15Cl2N3O
288.17 (anhydrous basis)
ACM879089642
CP 93129 DIHYDROCHLORIDE, 879089-64-2, SCHEMBL14127740, CTK8F0312, MolPort-003-983-540, AKOS024456342, 1,4-Dihydro-3-(1,2,3,6-tetrahydro-4-pyridinyl)-5H-pyrrol[3,2-b]pyridin-5-one dihydrochloride
CPA 1 HYDRATE
CAS:111258-00-5
296.23 (anhydrous basis)
ACM111258005
CPC
CAS:1803330-63-3
ACM1803330633
CPCCOET
CAS:179067-99-3
Formula: C13H13NO4
247.25
ACM179067993
CPHOS
CAS:1160556-64-8
Formula: C28H41N2P;
436.624g/mol
ACM1160556648
CPhos; Y-200010; 2-Dicyclohexylphosphino-2',6'-bis(N,N-dimethylamino)biphenyl; 1160556-64-8; SCHEMBL14736169; 2-(2-dicyclohexylphosphanylphenyl)-1-N,1-N,3-N,3-N-tetramethylbenzene-1,3-diamine; [1,1'-Biphenyl]-2,6-diamine, 2'-(dicyclohexylphosphino)-N2,N2,
CPHOS PD G2
746.70
ACM-00013649
CPHOS PD G3
806.34
ACM-00013650
CPHOS PD G4
820.37
ACM-00013651
CPM
CAS:76877-33-3
Formula: C24H22N2O4
402.44
ACM76877333
7-Diethylamino-3-(4-maleimidylphenyl)-4-methylcoumarin
CPTH2
CAS:357649-93-5
Formula: C14H14ClN3S
291.80
ACM357649935
CREATINE
CAS:57-00-1
Formula: C4H9N3O2
131.13
ACM57001
creatine, N-amidinosarcosine, Creatin, Kreatin, Krebiozon, methylglycocyamine, Creatine, hydrate, Pyrolysate, N-methyl-N-guanylglycine, Creatine (8CI), Methylguanidoacetic acid, (alpha-Methylguanido)acetic acid, methylguanidinoacetic acid, alpha-Methylgua
CREATINE CITRATE
CAS:177024-62-3
Formula: C10H17N3O9
323.26
ACM177024623
CREATINE CITRATE
CREATINE ETHYL ESTER HYDROCHLORIDE
CAS:15366-32-2
Formula: C6H14ClN3O2
195.65
ACM15366322
CREATINE ETHYL ESTER HYDROCHLORIDE;CREATINE ETHYL ESTER HCL (P);Creatine ethyl ester hydrochloridel;CREATINE ETHYL ESTER HCL(SH);Ethyl 2-(1-Methylguanidino)acetate hydrochloride;Glycine,N-(aMinoiMinoMethyl)-N-Methyl-, ethyl ester, hydrochloride (1:1);Crea
CREATINE HCL
CAS:17050-09-8
Formula: C4H10ClN3O2
167.5941
ACM17050098
Creatine HCL;CREATINE HYDROCHLORIDE;Glycine, N-(aminoiminomethyl)-N-methyl-, monohydrochloride;N-(Aminoiminomethyl)-N-methylglycine hydrochloride;Glycine,N-(aMinoiMinoMethyl)-N-Methyl-, hydrochloride (1:1)
CREATINE HEMISULFATE CRYSTALLINE
CAS:102601-28-5
Formula: C4H9N3O2??0.5H2O4S
180.17
ACM102601285
Creatine hemisulfate salt, (|A-Methylguanido)acetic acid, 102601-28-5
CREATINE KINASE (FROM RABBIT MUSCLE)
CAS:9026-66-8
1.0079
ACM9026668
CK, ATP: creatine N-phosphotransferase
CREATINE MONOHYDRATE
CAS:6020-87-7
Formula: C4H11N3O3
149.15
ACM6020877
N-GUANYL-N-METHYLGLYCINE;N-GUANYL-N-METHYLGLYCINE, MONOHYDRATE;N-METHYL-N-GUANYLGLYCINE MONOHYDRATE;N-AMIDINOSARCOSINE;N-AMIDINOSARCOSINE HYDRATE;N-AMIDINOSARCOSINE MONOHYDRATE;Glycine, N-(aminoiminomethyl)-N-methyl-, monohydrate;CREATINE HYDRATE
CREATINE PHOSPHATE DISODIUM SALT
CAS:922-32-7
Formula: C4H8N3Na2O5P
255.08
ACM922327
CREATINE PHOSPHATE DISODIUM SALT TETRAHYDRATE
CAS:71519-72-7
Formula: C4H8N3Na2O5P.4H2O
327.13
ACM71519727
CREATINE ZINC CHLORIDE
CAS:16045-72-0
Formula: C4H9N3O2Cl2Zn
267.42
ACM16045720
CREATININE
CAS:60-27-5
Formula: C4H7N3O
113.11
ACM60275
CREATININE HCL
CAS:19230-81-0
Formula: C4H7N3OHCl
149.58
ACM19230810
C6257_ALDRICH; 2-amino-1-methyl-1,5-dihydro-imidazol-4-one,hydrochloride; 2-Amino-1-methyl-1,5-dihydro-imidazol-4-on,Hydrochlorid; 2-imino-1-methylimidazolidin-4-one hydrochloride; 2-amino-1-methyl-2-imidazolin-4-one hydrochloride; Creatinine hydrochlorid
CREATININE-D3
CAS:143827-20-7
Formula: C4H4D3N3O
116.14
ACM143827207
CREMOPHOR(R)A25
CAS:68439-49-6
Formula: C18H38O
0
ACM68439496
alcohols,c16-18,ethoxylated;Alcohols,C16-18-ethoxylated;AliphaticC16-18-alcohol,ethoxylated;C16-18-Alkylalcohol,ethoxylate;C16-18-Alkylalcoholethoxylate;cremophora25;ethoxylatedfattyalcohols(c16-18);CETEARETH-2
CREMOPHOR(R)A25
CAS:68439-49-6
Formula: C18H38O
0
ACM68439496
alcohols,c16-18,ethoxylated;Alcohols,C16-18-ethoxylated;AliphaticC16-18-alcohol,ethoxylated;C16-18-Alkylalcohol,ethoxylate;C16-18-Alkylalcoholethoxylate;cremophora25;ethoxylatedfattyalcohols(c16-18);CETEARETH-2
CREOSOTE
CAS:8001-58-9
0
ACM8001589
awpa#1;brickoil;caswellno.225;creosote,fromcoaltar;creosoteoil;creosotep1;creosotum;cresyliccreosote
CREPENYNIC ACID
CAS:13214-35-2
Formula: C18H30O2
278.433
ACM13214352
CRESOL-FORMALDEHYDE COPOLYMER 1,2-NAPHTHOQUINONEDIAZIDO-4-SULFONATE
CAS:80296-78-2
Formula: (C10H6N2O4S)x.(C7H8O)n.(CH2O)n
0
ACM80296782
PQC;ESTER OF 2-DIAZO-1-NAPHTHOL-4-SULFONE WITH 4-CRESOL RESIN;Cresol-formaldehyde copolymer 1,2-naphthoquinonediazido-4-sulfonate;Cresol-formaldehyde copolymer 3-diazo-3,4-dihydro-4-oxo-1-naphthalenesulfonate;Formaldehyde polymer with methylphenol, 3-diaz
CRESSANTHER
CAS:5331-14-6
Formula: C12H18O
178.27
ACM5331146
(2-butoxyethyl)-benzen;(2-butoxyethyl)-Benzene;CRESSANTHER;PHENYLETHYL N-BUTYL ETHER;Benzene, (2-butoxyethyl)-;Butyl-(2-phenethyl) ether;Cognac oil,artificial;Butylphenethyl ether
CRESYL BLUE,BRILLIANT
CAS:51716-96-2
Formula: C34H40Cl4N6O2Zn
771.92
ACM51716962
BRILLIANT CRESYL BLUE ALD;BRILLIANT CRESYL BLUE ZINC CHLORIDE DOUBLE SALT;BRILLIANT BLUE C;CI NO 51010;CRESYL BLUE;CRESYL BLUE BBS;CRESYL BLUE, BRILLIANT;3-amino-7-(diethylamino)-2-methylphenoxazin-5-ium tetrachlorozincate (2:1)
CRESYL VIOLET PERCHLORATE,LASER GRADE
CAS:41830-80-2
Formula: C16H12N3O.ClO4
361.74
ACM41830802
CRESYL VIOLET PERCHLORATE;OXAZINE 9 PERCHLORATE;5,9-diamino-benzo[a]phenoxazin-7-iuperchlorate;5,9-diaminobenzo[a]phenoxazin-7-ium perchlorate;CRESYL VIOLET PERCHLORATE, FOR FLUORESCE NCE;Cresylvioletperchlorate,lasergrade;CRESYL VIOLET 670 PERCHLORATE);
CROCEIN SCARLET 7B
CAS:6226-76-2
Formula: C24H18N4Na2O7S2
584.53
ACM6226762
Crocein Scarlet 7B, 6226-76-2, CROCEINSCARLET7B, MolPort-018-616-984, AKOS000282843, A-8943
CROCEIN SCARLET 7B
CAS:6226-76-2
Formula: C24H18N4Na2O7S2
584.53
ACM6226762
Crocein Scarlet 7B, 6226-76-2, CROCEINSCARLET7B, MolPort-018-616-984, AKOS000282843, A-8943
CROCONIC ACID
CAS:488-86-8
Formula: C5H2O5
142.07
ACM488868
CROCONIC ACID,DISODIUM SALT
CAS:14379-00-1
Formula: C5Na2O5
186.03
ACM14379001
CROCONIC ACID, DISODIUM SALT;4,5-DIHYDROXY-4-CYCLOPENTENE-1,2,3-TRIONE, DISODIUM SALT;4,5-Dihydroxy-cyclopent-4-ene-1,2,3-trione disodiumsalt;Croconic acid disodium salt 97%
CRONIDIPINE
CAS:113759-50-5
Formula: C30H32ClN3O8
598.049
ACM113759505
Cronidipine;LF 2-0254;1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-[8-(4-chlorophenyl)-1,4-dioxa-8-azaspiro[4.5]decan-2-yl]methyl 5-methyl ester
CROSCARMELLOSE SODIUM
CAS:74811-65-7
0
ACM74811657
Sodiumcroscarmellose;CROSCARMELLOSE SODIUM;MODIFIED CELLULOSE GUM;PRIMELLOSE(R);Crosscarmelosesodium;Croscarmellose natrium;Cross-linked carboxymethylcellulose sodium;Unii-m28ol1hh48
CROSSTIDE
CAS:171783-05-4
Formula: C48H77N17O17
1164.228680 [g/mol]
ACM171783054
Crosstide, 171783-05-4
CROTAMITON
CAS:483-63-6
Formula: C13H17NO
203.28
ACM483636
CROTONALDEHYDE(DNPH DERIVATIVE)
CAS:1527-96-4
Formula: C10H10N4O4
250.21
ACM1527964
CROTONALDEHYDE,DAIH DERIVATIVE
CAS:103480-19-9
Formula: C27H22N2O2
406.48
ACM103480199
Crotonaldehyde, DAIH derivative, 3-(2-Butenylidene-hydrazono)-2-diphenylacetyl-indan-1-one, 2-Diphenylacetyl-indan-1,3-dione-1-(2-butenylidene)hydrazone, 103480-19-9
CROTONALDEHYDE-O-PENTAFLUOROPHENYLMETHYL-OXIME
CAS:932710-52-6
Formula: C11H8F5NO
265.18
ACM932710526
Crotonaldehyde O-2,3,4,5,6-PFBHA-oxime, Crotonaldehyde-O-pentafluorophenylmethyl-oxime, 2-Butenal oxime, o-[(pentafluorophenyl)methyl]-, 932710-52-6
CROTONIC ACID SEC-BUTYL ESTER
CAS:10371-45-6
Formula: C8H14O2
142.2
ACM10371456
sec-Butylcrotonate, sec-Butyl Crotonate, Crotonic acid, sec-butyl ester, Crotonic Acid sec-Butyl Ester, Sec-butyl (2E)-2-butenoate, MolPort-000-883-926, MolPort-001-781-986, c1184, 2-Butenoic acid, 1-methylpropyl ester, 2-Butenoic acid, 1-methylpropyl est
CROTONIC ACID TERT-BUTYL ESTER
CAS:3246-27-3
Formula: C8H14O2
142.2
ACM3246273
TERT-BUTYL CROTONATE;CROTONIC ACID TERT-BUTYL ESTER;2-Butenoic acid, 1,1-dimethylethyl ester;tert-butyl 2-butenoate ;Einecs 221-821-2;(E)-tert-butyl but-2-enoate
CROTONIC ANHYDRIDE
CAS:78957-07-0
Formula: C8H10O3
154.16
ACM78957070
TRANS-2-BUTENOIC ANHYDRIDE;CROTONIC ANHYDRIDE, 95%, PREDOMINANTLY T RANS;Crotonic anhydride 95%
CROTONOYL COENZYME A TRILITHIUM SALT
CAS:102680-35-3
Formula: C25H37Li3N7O17P3S1
853.41
ACM102680353
CROTONOYL COENZYME A TRILITHIUM SALT;CROTONOYL COENZYME A LITHIUM;2-butenoyl coenzyme a lithium salt;[(2R,3R,4R,5R)-5-(6-aminopurin-9-yl)-2-[[[[3-[2-(2-but-2-enoylsulfanylethylcarbamoyl)ethylcarbamoyl]-3-hydroxy-2,2-dimethyl-propoxy]-hydroxy-phosphoryl]o
CROTONYL CHLORIDE
CAS:10487-71-5
Formula: C4H5ClO
104.53
ACM10487715
2-Butenoyl chloride;2-butenoylchloride;but-2-enoylchloride;TRANS-2-BUTENOYL CHLORIDE;CROTONYL CHLORIDE;CROTONOYL CHLORIDE;CROTONIC ACID CHLORIDE;E-CROTONYL CHLORIDE
CROTONYL GLYCINE
CAS:71428-89-2
0
ACM71428892
Crotonyl glycine
CROTYL BROMIDETECH.85
CAS:29576-14-5
Formula: C4H7Br
135.00238
ACM29576145
CROTYL BROMIDETECH.85;(E)-1-bromo-2-butene;(e)-2-buten;2-butene,1-bromo-,(E)-;trans-1-bromo-but-2-ene;trans-Crotyl bromide;CROTYL BROMIDE, TECH., 85%;trans-Crotyl bromide, remainder 3-bromo-1-butene, 85%
CROTYL CHLORIDE,PREDOMINANTLY TRANS
CAS:4894-61-5
Formula: C4H6Br2
90.55
ACM4894615
Crotyl chloride, Krotylchlorid, 2-Butenyl chloride, 2-Butene, 1-chloro-, 1-Chlorobut-2-ene, Krotylchlorid [Czech], sJPHADIJtp@, gamma-Methallyl chloride, 1-CHLORO-2-BUTENE, gamma-Methylallyl chloride, trans-1-Chloro-2-butene, (E)-1-Chloro-2-butene, (E)-1-
CROTYLPALLADIUM CHLORIDE DIMER
CAS:12081-22-0
Formula: C8H14Cl2Pd2
393.94
ACM12081220
(2-Butenyl)chloropalladium dimer, Di-2-butenyldipalladium dichloride, Dichlorobis(1-methylallyl)dipalladium, 12081-22-0, Di-|Eth-Crotylpalladium chloride, CROTYLPALLADIUM CHLORIDE DIMER, DI-PI-CROTYLPALLADIUM CHLORIDE, SC10504, Bis[(1,2,3-|C)-2-buten-1-yl
CROWN ETHER/N-PHENYLAZA-15-CROWN-5
CAS:66750-10-5
Formula: C16H25NO4
295.37
ACM66750105
CRYOLITE
CAS:15096-52-3
Formula: Na3AlF6;AlF6Na3;AlF6Na3;
209.941g/mol
ACM15096523
Cryolite for evaporation techniques; Aluminum sodium fluoride; 15096-52-3; 5ZIS914RQ9; Aluminum sodium hexafluoride; UNII-5ZIS914RQ9; CHEBI:39289; Kryolite; trisodium hexafluoridoaluminate; 5473AF;
CRYPTOLEPINE HYDRATE
CAS:480-26-2
Formula: C16H12N2
232.28 (anhydrous basis)
ACM480262
5-methylindolo[3,2-b]quinoline; 5-Methyl-5H-quindoline hydrate; Cryptolepine hydrate;
CRYSTAL PONCEAU 6R
CAS:2766-77-0
Formula: C20H14N2O7S2.2Na
502.43
ACM2766770
ACID RED 44;CRYSTAL SCARLET;CRYSTAL PONCEAU;CRYSTAL PONCEAU 6R;CI 16250;CI NO 16250;BRILLIANT CRYSTAL SCARLET;crystalscarlet(acidred44)
CRYSTAL PONCEAU 6R
CAS:2766-77-0
Formula: C20H14N2O7S2.2Na
502.43
ACM2766770
ACID RED 44;CRYSTAL SCARLET;CRYSTAL PONCEAU;CRYSTAL PONCEAU 6R;CI 16250;CI NO 16250;BRILLIANT CRYSTAL SCARLET;crystalscarlet(acidred44)
CRYSTAL VIOLET
CAS:548-62-9
Formula: C25H30ClN3
407.99
ACM548629
PYOKTANIN BLUE;S NO 785;VIOLET 7B;BASIC VIOLET 3;BRILLIANT VIOLET;CALCOZINE VIOLET 6BN;GRAM STAIN NO 1;GRAM STAIN
CRYSTAL VIOLET
CAS:39393-39-0
Formula: C30H33IN2O3
596.50
ACM39393390
BRILLIANT VIOLET;CRYSTAL VIOLET BASE;CRYSTAL (GENTIAN) VIOLET;CALCOZINE VIOLET 6BN;CI NO 42555;CI NO 42555/42535;GENTIAN VIOLET, HUCKER'S;GENTIAN VIOLET 10B
CRYSTAL VIOLET LACTONE
CAS:1552-42-7
Formula: C26H29N3O2
415.53
ACM1552427
CRYSTAL VIOLET NONAHYDRATE [ION ASSOCIATION REAGENT FOR SPECTROPHOTOMETRIC ANALYSIS]
CAS:60662-33-1
ACM60662331-1
CRYSTAL VIOLETNONAHYDRATE[ION ASSOCIATION REAGENT FOR SPECTROPHOTOMETRIC ANALYSIS]
CAS:60662-33-1
Formula: C25H30ClN3.9H2O
407.98
ACM60662331
Crystal violet, gentian violet, Basic violet 3, Methylrosaniline chloride, Hexamethyl Violet, Hexamethylpararosaniline chloride, Aniline Violet, Gentioletten, Gentersal, Gentiaverm, Genticid, Oxycolor, Pyoktanin, Vermicid, Adergon, Atmonil, Avermin, Axuri
CS-866
CAS:144689-63-4
Formula: C24H26N6O3
446.5
ACM144689634
4-(1-hydroxy-1-methylethyl)-2-propyl-1-((2-(1H-tetrazol-5-yl)(1,1-biphenyl)-4-yl)methyl-1H-Imidazole-5-carboxylic acid, (5-methyl -2-oxo-1,3-dioxol-4-yl) methyl ester;Benicar;OlmesartanC29H30N6O6;CS-866, 4-(1-Hydroxy-1-methylethyl)-2-propyl-1-[[2(1H-tetaz
CSFC 127
CAS:40470-68-6
Formula: C30H26O2
418.53
ACM40470686
CTB
CAS:451491-47-7
343.73
ACM451491477
CTP INHIBITOR
CAS:412940-35-3
Formula: C13H9ClN2O6S
356.74
ACM412940353
CTP Inhibitor, BAS 00679959, AC1LL5HE, Ambcb6652048, Oprea1_649848, MolPort-001-942-962, AKOS000731078, MCULE-7095318203, 4-Chloro-3-(3-nitro-phenylsulfamoyl)-benzoic acid, 4-chloro-3-[(3-nitrophenyl)sulfamoyl]benzoic acid, ZINC Compound 792949; 4-Chloro-
CU(DAP)2 CHLORIDE
883.90
ACM-00013543
CUBEBIN
CAS:18423-69-3
Formula: C20H20O6
356.37
ACM18423693
CUBEBIN;tetrahydro-3,4-dipiperonylfuran-2-ol;CUBEBIN(RG);3,4-Bis[(1,3-benzodioxol-5-yl)methyl]tetrahydrofuran-2-ol;[[3R,(-)]-3a,4-Bis[(1,3-benzodioxole-5-yl)methyl]tetrahydrofuran]-2-ol;.beta.-Cubebin;2-Furanol, 3,4-bis(1,3-benzodioxol-5-ylmethyl)tetrahy
CUCURBIT(8)URIL
CAS:259886-51-6
Formula: C48H48N32O16
1329.1
ACM259886516
Cucurbit[8]uril;Curcubit[8]uril;Cucurbit[8]uril (CB[8]) hydrate, 99+%;Cucurbit[8]uril hydrate contains acid of crystalization;Cucurbit[8]uril hydrate;2,20:3,19-Dimethano-2,3,4a,5a,6a,7a,8a,9a,10a,11a,12a,13a,14a,15a,16a,17a,19,20,21a,22a,23a,24a,25a,26a,2
CUCURBIT[7]URIL HYDRATE
CAS:259886-50-5
Formula: C42H42N28O14
1162.96
ACM259886505
CUCURBITACIN A
CAS:6040-19-3
Formula: C32H46O9
ACM6040193
CUCURBITACIN D
CAS:3877-86-9
Formula: C30H44O7
516.67
ACM3877869
CUCURBITACIN D;ELATERICIN A;20,25-tetrahydroxy-ph;cucurbitacine(d);elatericinea;CUCURBITACIN D WITH HPLC;(10a,23E)-2,16a,20,25-Tetrahydroxy-9-methyl-19-norlanosta-5,23-diene-3,11,22-trione;(9,10a,23E)-2,16a,20,25-Tetrahydroxy-9-methyl-19-norlanosta-5,
CUCURBITURIL
CAS:80262-44-8
Formula: C36H36N24O12
996.82
ACM80262448
CUCURBITURIL;Cucurbituril[6];1H,4H,14H,17H-2,16:3,15-Dimethano-5H,6H,7H,8H,9H,10H,11H,12H,13H,18H,19H,20H,21H,22H,23H,24H,25H,26H-2,3,4a,5a,6a,7a,8a,9a,10a,11a,12a,13a,15,16,17a,18a,19a,20a,21a,22a,23a,24a,25a,26a-tetracosaazabispentaleno1,6:5,6,7cyclooct
CUG
CAS:64664-99-9
Formula: C16H16O10
368.29
ACM64664999
3-Carboxyumbelliferyl beta-D-galactopyranoside
CUMIN,EXT.
CAS:84775-51-9
ACM84775519
CUMYL PEROXYNEOHEPTANOATE
CAS:130097-36-8
Formula: C16H24O3
ACM130097368
Neoheptaneperoxoic acid, 1-methyl-1-phenylethyl ester
CUNC
CAS:33273-09-5
Formula: C48H24CuN8
776.3
ACM33273095
COPPER(II) 2,3-NAPHTHALOCYANINE;2,3-NAPHTHALOCYANINE COPPER(II) SALT;Copper(II) 2,3-naphthalocyanine,2,3-Naphthalocyanine copper(II) salt;CuNC
CUPC
CAS:147-14-8
Formula: C32H16CuN8
576.07
ACM147148
(phthalocyaninato(2-))-coppe;(phthalocyaninato(2-))copper;(sp-4-1)-);31h-phthalocyaninato(2-)-n(29),n(30),n(31),n(32))-(29(sp-4-1)-coppe;31h-phthalocyaninato(2-)-n29,n39,n31,n32]-[29(sp-4-1)-coppe;6430;accospersecyanbluegt;aqualineblue
CUPC
CAS:147-14-8
Formula: C32H16CuN8
576.07
ACM147148
(phthalocyaninato(2-))-coppe;(phthalocyaninato(2-))copper;(sp-4-1)-);31h-phthalocyaninato(2-)-n(29),n(30),n(31),n(32))-(29(sp-4-1)-coppe;31h-phthalocyaninato(2-)-n29,n39,n31,n32]-[29(sp-4-1)-coppe;6430;accospersecyanbluegt;aqualineblue
CUPC-8H
CAS:153151-22-5
ACM153151225
CUPREINE
CAS:524-63-0
Formula: C19H22N2O2
310.395
ACM524630
cupreine ;(8,9R)-9-Diol Cinchonan-6 Cupreine;O-Demethylquinidine;O-Desmethyl Quinine;Ultraquinine;6-hydroxycinchonidine;(8,9R)-9-Diol Cinchonan-6';C06530
CUPRESSUFLAVONE 3-HYDRATE
CAS:3952-18-9
Formula: C30H18O10
592.5
ACM3952189
CUPRESSUFLAVONE;CUPRESSUFLAVONE TRIHYDRATE;4',4''',5,5'',7,7''-HEXAHYDROXY-8,8''-BIFLAVONE;CUPRESSUFLAVONE TRIHYDRATE WITH HPLC;CUPRESSUFLAVONE Trihydrate hplc;CUPRESSUFLAVONE WITH HPLC;5,5',7,7'-Tetrahydroxy-2,2'-bis(4-hydroxyphenyl)[8,8'-bi(4H-1-benzop
CUPRIC ACETATE
CAS:142-71-2
Formula: C4H6CuO4
181.63
ACM142712
BARFOEDS REAGENT;COPPER ACETATE;COPPER(II) ACETATE;CUPRIC ACETATE;acetatedecuivre;acetatedecuivre(french);aceticacid,copper(2+);Aceticacid,copper(2+)salt
CUPRIC CARBONATE
123.55
ACM-00013544
CUPRIC FLUORIDE
CAS:13454-88-1
Formula: CuF22H2O
137.57
ACM13454881
CUPRIC LACTATE.
CAS:814-81-3
Formula: C6H10CuO6
0
ACM814813
Copper dihexanoate; bis(D,L-lactato)copper(II); copper(II) lactate; copper caprylate; DL-Milchsaeure,Kupfer(II)-lactat; EINECS 236-758-6; copper caprate; Kupfer(II)-hexanoat; copper(II) hexanoate; DL-lactic acid,copper (II)-lactate; copper lactate; copper
CUPRIC LACTATE.
CAS:814-81-3
Formula: C6H10CuO6
0
ACM814813
Copper dihexanoate; bis(D,L-lactato)copper(II); copper(II) lactate; copper caprylate; DL-Milchsaeure,Kupfer(II)-lactat; EINECS 236-758-6; copper caprate; Kupfer(II)-hexanoat; copper(II) hexanoate; DL-lactic acid,copper (II)-lactate; copper lactate; copper
CUPRIC NITRATE
CAS:3251-23-8
Formula: Cu.(NO3)2
187.55
ACM3251238
CURCUMIN(SYNTHETIC)
CAS:94875-80-6
Formula: C21H20O6
368.38
ACM94875806
CURDLAN
CAS:54724-00-4
0
ACM54724004
CURDLAN;CURDIAN;BETA-1,3-GLUCAN, HYDRATE;curdlan from alcaligenes faecalis;CURDIAN(FROMALCALIGENESFAECALIS;-1,3-Glucanhydrate;Curdlall;Curdran
CUSCOHYGRINE(MIXTURE OF DIASTEREOMERS)
CAS:454-14-8
Formula: C13H24N2O
224.34
ACM454148
1,3-bis[(2s)-1-methylpyrrolidin-2-yl]propan-2-one;cuscohygrine;1,3-bis(1-methyl-2-pyrrolidinyl)acetone;1,3-BIS(1-METHYL-2-PYRROLIDINYL)PROPANONE;Cuskhygrine;Hellaradine;1,3-Bis[1-methylpyrrolidin-2-yl]propan-2-one;C06521
CUSTOMIZED MWNTS DISPERSION
CAS:7440-44-0
ACM7440440-150
CV-3988
CAS:85703-73-7
Formula: C28H53N2O7PS
592.77
ACM85703737
CV-6209
CAS:100488-87-7
Formula: C34H60ClN3O6
642.31
ACM100488877
2-(2-Acetyl-6-methoxy-3,9-dioxo-4,8-dioxa-2,10-diazaoctacos-1-yl)-1-ethyl-pyridinium Chloride;
CVD GRAPHENE FILM ON NICKEL 1-7 LAYERS ,1CMX1CM
CAS:7440-44-0
ACM7440440-144
CVD GRAPHENE FILM ON NICKEL 5CMX5CM
CAS:7440-44-0
ACM7440440-123
CVD GRAPHENE ON COPPER FOIL 10CMX10CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-59
CVD GRAPHENE ON COPPER FOIL 10CMX10CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-60
CVD GRAPHENE ON COPPER FOIL 10CMX10CM(BILAYER)
CAS:7440-44-0
ACM7440440-36
CVD GRAPHENE ON COPPER FOIL 10CMX10CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-18
CVD GRAPHENE ON COPPER FOIL 10CMX5CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-116
CVD GRAPHENE ON COPPER FOIL 10CMX5CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-131
CVD GRAPHENE ON COPPER FOIL 10CMX5CM(BILAYER)
CAS:7440-44-0
ACM7440440-148
CVD GRAPHENE ON COPPER FOIL 10CMX5CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-113
CVD GRAPHENE ON COPPER FOIL 15CMX10CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-27
CVD GRAPHENE ON COPPER FOIL 15CMX10CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-28
CVD GRAPHENE ON COPPER FOIL 15CMX10CM(BILAYER)
CAS:7440-44-0
ACM7440440-107
CVD GRAPHENE ON COPPER FOIL 15CMX10CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-14
CVD GRAPHENE ON COPPER FOIL 2CMX2CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-20
CVD GRAPHENE ON COPPER FOIL 2CMX2CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-51
CVD GRAPHENE ON COPPER FOIL 2CMX2CM(BILAYER)
CAS:7440-44-0
ACM7440440-53
CVD GRAPHENE ON COPPER FOIL 2CMX2CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-22
CVD GRAPHENE ON COPPER FOIL 30CMX20CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-253
CVD GRAPHENE ON COPPER FOIL 30CMX20CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-243
CVD GRAPHENE ON COPPER FOIL 30CMX20CM(BILAYER)
CAS:7440-44-0
ACM7440440-203
CVD GRAPHENE ON COPPER FOIL 30CMX20CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-19
CVD GRAPHENE ON COPPER FOIL 5CMX5CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-5
CVD GRAPHENE ON COPPER FOIL 5CMX5CM(6-7 LAYERS)
CAS:7440-44-0
ACM7440440-135
CVD GRAPHENE ON COPPER FOIL 5CMX5CM(BILAYER)
CAS:7440-44-0
ACM7440440-56
CVD GRAPHENE ON COPPER FOIL 5CMX5CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-52
CVD GRAPHENE ON COPPER FOIL1CMX1CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-58
CVD GRAPHENE ON COPPER FOIL1CMX1CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-57
CVD GRAPHENE ON COPPER FOIL1CMX1CM(BILAYER)
CAS:7440-44-0
ACM7440440-54
CVD GRAPHENE ON COPPER FOIL1CMX1CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-61
CVD GRAPHENE ON GLASS 1CMX1CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-127
CVD GRAPHENE ON GLASS 1CMX1CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-31
CVD GRAPHENE ON GLASS 1CMX1CM(BILAYER)
CAS:7440-44-0
ACM7440440-250
CVD GRAPHENE ON GLASS 1CMX1CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-163
CVD GRAPHENE ON PLASTIC 1CMX1CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-201
CVD GRAPHENE ON PLASTIC 1CMX1CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-202
CVD GRAPHENE ON PLASTIC 1CMX1CM(BILAYER)
CAS:7440-44-0
ACM7440440-209
CVD GRAPHENE ON PLASTIC 1CMX1CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-185
CVD GRAPHENE ON QUARTZ (1MM)1CMX1CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-149
CVD GRAPHENE ON QUARTZ (1MM)1CMX1CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-195
CVD GRAPHENE ON QUARTZ (1MM)1CMX1CM(BILAYER)
CAS:7440-44-0
ACM7440440-142
CVD GRAPHENE ON QUARTZ (1MM)1CMX1CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-79
CVD GRAPHENE ON QUARTZ 1CMX1CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-129
CVD GRAPHENE ON QUARTZ 1CMX1CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-128
CVD GRAPHENE ON QUARTZ 1CMX1CM(BILAYER)
CAS:7440-44-0
ACM7440440-244
CVD GRAPHENE ON QUARTZ 1CMX1CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-90
CVD GRAPHENE ON SI 1CMX1CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-280
CVD GRAPHENE ON SI 1CMX1CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-277
CVD GRAPHENE ON SI 1CMX1CM(BILAYER)
CAS:7440-44-0
ACM7440440-279
CVD GRAPHENE ON SI 1CMX1CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-278
CVD GRAPHENE ON SI 2.5CMX2.5CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-154
CVD GRAPHENE ON SI 2.5CMX2.5CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-111
CVD GRAPHENE ON SI 2.5CMX2.5CM(BILAYER)
CAS:7440-44-0
ACM7440440-145
CVD GRAPHENE ON SI 2.5CMX2.5CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-152
CVD GRAPHENE ON SIO2 1CMX1CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-164
CVD GRAPHENE ON SIO2 1CMX1CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-137
CVD GRAPHENE ON SIO2 1CMX1CM(BILAYER)
CAS:7440-44-0
ACM7440440-120
CVD GRAPHENE ON SIO2 1CMX1CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-78
CVD GRAPHENE ON SIO2 2CMX2CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-11
CVD GRAPHENE ON SIO2 2CMX2CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-77
CVD GRAPHENE ON SIO2 2CMX2CM(BILAYER)
CAS:7440-44-0
ACM7440440-65
CVD GRAPHENE ON SIO2 2CMX2CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-165
CVD GRAPHENE ON SIO2 7CMX7CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-248
CVD GRAPHENE ON SIO2 7CMX7CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-85
CVD GRAPHENE ON SIO2 7CMX7CM(BILAYER)
CAS:7440-44-0
ACM7440440-140
CVD GRAPHENE ON SIO2 7CMX7CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-115
CVDGRAPHENE ON SIO2 5CMX5CM(3-5 LAYERS)
CAS:7440-44-0
ACM7440440-134
CVDGRAPHENE ON SIO2 5CMX5CM(6-8 LAYERS)
CAS:7440-44-0
ACM7440440-130
CVDGRAPHENE ON SIO2 5CMX5CM(BILAYER)
CAS:7440-44-0
ACM7440440-133
CVDGRAPHENE ON SIO2 5CMX5CM(MONOLAYER)
CAS:7440-44-0
ACM7440440-81
CX-3543
CAS:865311-47-3
Formula: C35H33FN6O3
604.6733232
ACM865311473
CX-3543;2-(4-((R)-1-Methylpyrrolidin-2-yl)butanoyl)-6-(3-(pyrazin-2-yl)pyrrolidin-1-yl)-3H-benzo[b]pyrido[3,2,1-kl]phenoxazin-3-one;5-Fluoro-N-[2-[(2S)-1-methyl-2-pyrrolidinyl]ethyl]-3-oxo-6-[3-(2-pyrazinyl)-1-pyrrolidinyl]-3H-benzo[b]pyrido[3,2,1-kl]phen
CY-CBRIDP
CAS:1023330-38-2
Formula: C28H37P;
404.578g/mol
ACM1023330382
Dicyclohexyl(2,2-diphenyl-1-methyl-1-cyclopropyl)phosphine; Cy-cBRIDP; 1-(Dicyclohexylphosphino)-2,2-Diphenyl-1-methylcyclopropane; Cy-cBRIDP, 97%; Dicyclohexyl(2,2-diphenyl-1-methylcyclopropyl)phosphine Cy-BRIDP; Dicyclohexyl(1-methyl-2,2-diphenylcyclopr
CY-VBRIDP
CAS:384842-24-4
Formula: C27H35P;
390.551g/mol
ACM384842244
AKOS025295265; ACM384842244; CTK8E6999; 1,1-Diphenyl-2-(dicyclohexylphosphino)propene; 1-Methyl-2,2-diphenylvinyldicyclohexylphosphine; Cy-vBRIDP; 2-(Dicyclohexylphosphino)-1,1-diphenyl-1-propene, Dicyclohexyl(1-methyl-2,2-diphenylvinyl)phosphine; Cy-vBRI
CY2 CARBOXYLIC ACIDS
CAS:260430-02-2
Formula: C25H27IN2O4
546.41
ACM260430022
CY3 AMINE
Formula: C36H52Cl2N4O
627.7
ACM-00003078
CY3 AZIDE
Formula: C33H43ClN6O
575.2
ACM-00000161
CY3 CARBOXYLIC ACIDS
CAS:1251915-29-3
Formula: C30H37ClN2O2
493.09
ACM1251915293
CY3 HYDRAZIDE
Formula: C30H40Cl2N4O
543.6
ACM-00000151
CY3 MALEIMIDE
Formula: C36H43ClN4O3
615.22
ACM-00000165
CY3 NHS ESTER
CAS:1032815-92-1
Formula: C34H40ClN3O4
590.15
ACM1032815921
CY3 NHS ESTER POTASSIUM SALT (1:1)
CAS:945529-56-6
Formula: C35H40KN3O10S2
765.93
ACM945529566
CY3.5 CARBOXYLIC ACID
CAS:1144107-79-8
Formula: C38H41ClN2O2
593.2
ACM1144107798
CY3.5 CARBOXYLIC ACIDS
CAS:1802928-88-6
Formula: C38H41ClN2O2
593.21
ACM1802928886
CY3.5 NHS ESTER
Formula: C42H44ClN3O4
690.28
ACM-00000184
CY5 ALKYNE
CAS:1223357-57-0
Formula: C35H42ClN3O
556.2
ACM1223357570
CY5 AMINE
Formula: C38H54Cl2N4O
653.78
ACM-00003079
CY5 AZIDE
Formula: C35H45ClN6O
601.24
ACM-00000163
CY5 BOC-HYDRAZIDE
Formula: C37H49ClN4O3
633.3
ACM-00000064
CY5 CARBOXYLIC ACIDS
CAS:2089113-08-4
Formula: C32H39ClN2O2
519.13
ACM2089113084
CY5 COOH POTASSIUM SALT(1:1)
CAS:449175-58-0
Formula: C33H39KN2O8S2
694.9
ACM449175580
CY5 HYDRAZIDE
Formula: C32H42Cl2N4O
569.6
ACM-00003076
CY5 MALEIMIDE
Formula: C38H45ClN4O3
641.25
ACM-00000176
CY5-PEG3-AZIDE
Formula: C40H55ClN6O4
719.4
ACM-00000072
CY5-PEG4-ACID
Formula: C43H60ClN3O7
766.4
ACM-00003086
CY5-PEG5-AMINE HCL SALT
Formula: C44H66Cl2N4O6
817.9
ACM-00000219
CY5-PEG5-AZIDE
Formula: C44H63ClN6O6
807.5
ACM-00000216
CY5-PEG6-ACID
Formula: C47H68ClN3O9
854.5
ACM-00000237
CY5-PEG6-NHS ESTER
Formula: C51H71ClN4O11
951.6
ACM-00000246
CY5.5 ALKYNE
Formula: C44H48ClN3O
670.34
ACM-00000181
CY5.5 ALKYNE
CAS:1628790-37-3
Formula: C43H46ClN3O
656.3
ACM1628790373
CY5.5 AMINE
Formula: C46H58Cl2N4O
753.9
ACM-00003085
CY5.5 CARBOXYLIC ACID
CAS:1449612-07-0
Formula: C40H43ClN2O2
619.3
ACM1449612070
CY5.5 CARBOXYLIC ACIDS
CAS:1449661-34-0
Formula: C41H45N2O2+
597.82
ACM1449661340
CY5.5 DBCO
CAS:1857352-95-4
Formula: C59H58N4O14S4
1175.4
ACM1857352954
CY5.5 HYDRAZIDE
Formula: C40H46Cl2N4O
669.7
ACM-00000180
CY5.5 MALEIMIDE
Formula: C46H51ClN4O3
743.39
ACM-00000196
CY5.5 NHS ESTER
Formula: C44H46ClN3O4
716.32
ACM-00000189
CY7 AMINE
Formula: C43H60Cl2N4O
719.88
ACM-00003083
CY7 AZIDE
Formula: C37H47ClN6O
627.27
ACM-00000348
CY7 CARBOXYLIC ACIDS
CAS:1628790-40-8
Formula: C37H45ClN2O2
585.22
ACM1628790408
CY7 MALEIMIDE
Formula: C43H51ClN4O3
707.4
ACM-00000186
CY7 NHS ESTER
Formula: C41H48ClN3O4
682.3
ACM-00000183
CY7.5 AMINE
Formula: C51H64Cl2N4O
820
ACM-00000422
CY7.5 CARBOXYLIC ACID
Formula: C45H49ClN2O2
685.4
ACM-00003082
CY7.5 MALEIMIDE
Formula: C51H55ClN4O3
807.5
ACM-00003091
CY7.5 NHS ESTER
Formula: C49H52ClN3O4
782.42
ACM-00000208
CYANAMIDE,(3-ACETYLPHENYL)-(9CI)
CAS:102711-76-2
ACM102711762
CYANIMIDODITHIOCARBONIC ACID S-METHYL ESTER S-POTASSIUM SALT
CAS:10191-61-4
Formula: C3H3KN2S2
170.3
ACM10191614
Cyanimidodithiocarbonic acid S-methyl ester S-potassium salt;Cyanimidodithiocarbonic acid monomethyl ester monopotassium salt
CYANIN CHLORIDE
CAS:2611-67-8
Formula: C27H31ClO16
646.97844
ACM2611678
2-(3,4-dihydroxyphenyl)-3,5-bis(beta-D-glucopyranosyloxy)-7-hydroxy-1-benzopyrylium chloride ;cyanidin-3,5-di-O-G;CYANIN CHLORIDE WITH HPLC;Cyanidol 3,5-diglucoside chloride;Cyanidin-3,5-O-diglucoside chloride;Cyanidin 3,5-diglucoside chloride
CYANINE3 ALKYNE
Formula: C33H40ClN3O
530.15
ACM-00003075
CYANINE3 NHS ESTER
CAS:1032678-38-8
Formula: C34H40ClN3O4
590.16
ACM1032678388
Cy3 NHS ester
CYANINE5 ALKYNE
Formula: C43H46ClN3O
656.31
ACM-00003080
CYANINE5 NHS ESTER
CAS:1032678-42-4
Formula: C36H42ClN3O4
616.2
ACM1032678424
CYANINE5.5 NHS ESTER
CAS:1469277-96-0
Formula: C44H46ClN3O4
716.31
ACM1469277960
CYANINE7 ALKYNE
Formula: C40H48ClN3O
622.29
ACM-00003077
CYANINE7 NHS ESTER
Formula: C41H48ClN3O4
682.3
ACM-00000182
CYANOACETYLENE
CAS:1070-71-9
Formula: C3HN
51.04
ACM1070719
1-Cyanoethyne
CYANOACETYLENE
CAS:1070-71-9
Formula: C3HN
51.04
ACM1070719
1-Cyanoethyne
CYANODITOLYLTETRAZOLIUM CHLORIDE
CAS:102568-47-8
Formula: C16H14ClN5
311.77
ACM102568478
CTC;CYANODITOLYL TETRAZOLIUM CHLORIDE;5-CYANO-2,3-BIS(4-METHYLPHENYL)-2H-TETRAZOLIUM CHLORIDE;5-CYANO-2,3-DI-(P-TOLYL)TETRAZOLIUM CHLORIDE;5-CYANO-2,3-DITOLYL TETRAZOLIUM CHLORIDE;5-cyano-2,3-ditolyltetrazolium;5-cyano-2,3-di-4-tolyltetrazolium chloride
CYANOETHYL CELLULOSE
CAS:9004-41-5
Formula: C36H46N8O11
ACM9004415
cellulose,2-cyanoethylether;TRICYANOETHYLCELLULOSE;CELLULOSE, CYANOETHYLATED;CELLULOSE, CYANOETHYLATED POLYMER;CELLULOSE, CYANOETHYL ETHER;CYANOETHYL CELLULOSE;CAT 4687;Cellulose ethylcyanide
CYANOETHYL PULLULAN
CAS:77466-56-9
0
ACM77466569
CYANOETHYL PULLULAN;Pullulan,cyanoethyl ether
CYANOFERROCENE
CAS:1273-84-3
Formula: C6H4N.C5H5.Fe
211.044
ACM1273843
Cyanoferrocene;Cyclopentadienecarbonitrile, cyclopentadienyliron deriv.;Ferrocenyl cyanide;Ferrocenylnitrile;Ferrocene, cyano-
CYANOGEN BROMIDE-ACTIVATED MATRIX
CAS:68987-32-6
ACM68987326
CYANOGEN-15N BROMIDE
CAS:63419-72-7
Formula: CBrN
106.91
ACM63419727
Cyanogen-15N bromide, 63419-72-7
CYANOMALONDIALDEHYDE
CAS:69791-38-4
Formula: C4H3NO2
97.07212
ACM69791384
CyanoMalondialdehyde
CYANOMETHYL ACETATE
CAS:1001-55-4
Formula: C4H5NO2
99.088 g/mol
ACM1001554
CYANOMETHYL TRIPHENYLPHOSPHONIUM CHLORIDE
CAS:4336-70-3
Formula: C20H17ClNP;
337.787g/mol
ACM4336703
A826259; FT-0604892; AC1L52RW; cyanomethyl(triphenyl)phosphanium chloride; 2-(triphenylphosphino)ethanenitrile, chloride; AK117458; SCHEMBL666994; C1739; KS-00000EK3; ACM4336703;
CYANOMETHYLENETRIBUTYLPHOSPHORANE
CAS:157141-27-0
Formula: C14H28NP
241.35
ACM157141270
CYANURIC ACID
CAS:108-80-5
Formula: C3H3N3O3
129.07
ACM108805
TRICARBIMIDE;TRICYANIC ACID;trihydroxy-1,3,5-triazine;Trihydroxycyanidine;,4,6-Trihydroxy-S-triazine;,4,6-Trioxohexahydro-1,3,5-triazine;[1,3,5]triazinane-2,4,6-trione;[1,3,5]Triazintrion
CYASTERONE
CAS:17086-76-9
Formula: C29H44O8
520.65
ACM17086769
cyasteron; Cyasterone;
CYAZOFAMID
CAS:120116-88-3
Formula: C13H13ClN4O2S
324.79
ACM120116883
RANMAN;MILDICUT;IKF-916;DOCIOUS;CYAZOFAMID;4-CHLORO-1-(DIMETHYLAMINOSULFONYL)-5-(P-TOLYL)IMIDAZOLE-2-CARBONITRILE;Fenamidone, Pestanal;cyazofamid (bsi, pa iso)
CYCLAMIC ACID
CAS:100-88-9
Formula: C6H13NO3S
179.23
ACM100889
CYCLAZOSIN HYDROCHLORIDE
CAS:146929-33-1
Formula: C23H27N5O4
473.95
ACM146929331
CYCLIC ARG-GLY-ASP-D-TYR-LYS
CAS:250612-42-1
Formula: C27H41N9O8.(CF3COOH)2
847.71
ACM250612421
CYCLIC INOSINE DIPHOSPHATE-RIBOSE
CAS:159501-36-7
ACM159501367
CYCLIC-OLIGO BIS[(1R,2R)-(+)-1,2-CYCLOHEXANEDIAMINO-N,N-BIS(3,3-DI-T-BUTYLSALICYLIDENE) COBALT(III)TRIFLATE]-5,5-BIS(2-CARBOXYETHYL)ETHER
CAS:647036-07-5
Formula: C70H90Co2F6N4O20S2;
1603.475g/mol
ACM647036075
MFCD28144555;647036-07-5;Cyc.-Oligo Bis[(1R,2R)-1,2-cyclohexanediamino-N,N'-bis(3,3'-di-t-butylsalicylidene) Co(III)OTf]-5,5'-bis(2-carboxyethyl)ether;
CYCLIC-OLIGO BIS[(1S,2S)-(-)-1,2-CYCLOHEXANEDIAMINO-N,N-BIS(3,3-DI-T-BUTYLSALICYLIDENE) COBALT(III)TRIFLATE]-5,5-BIS(2-CARBOXYETHYL)ETHER
CAS:1252661-94-1
Formula: C70H90Co2F6N4O20S2;
1603.475g/mol
ACM1252661941
MFCD28144556;1252661-94-1;Cyc-Oligo Bis[(1S,2S)-(-)-1,2-cyclohexanediamino-N,N'-bis(3,3'-di-t-Busalicylidene) Co(III)OTf]-5,5'-bis(2-carboxyEt)ether;Cyclic-Oligo Bis[(1S,2S)-(-)-1,2-cyclohexanediamino-N,N'-bis(3,3'-di-t-butylsalicylidene) cobalt(III)trifl
CYCLIZINE
CAS:82-92-8
Formula: C18H22N2
266.40
ACM82928
1-benzhydryl-4-methylpiperazine
CYCLO(-ALA-SER)
CAS:155225-26-6
Formula: C6H10N2O3
158.16
ACM155225266
CYCLO(-ARG-ALA-ASP-D-PHE-VAL)
CAS:137813-36-6
Formula: C27H40N8O7
588.66
ACM137813366
CYCLO(-D-ALA-D-ALA)
CAS:23927-13-1
Formula: C6H10N2O2
142.16
ACM23927131
CYCLO(-D-ALA-L-PRO)
CAS:36238-64-9
Formula: C8H12N2O2
168.2
ACM36238649
Cyclo(-D-Ala-L-Pro), CTK8F8840, AKOS006274202, AG-F-26178, 36238-64-9, Pyrrolo[1,2-a]pyrazine-1,4-dione,hexahydro-3-methyl-, (3R-cis)-; Cyclo(L-prolyl-D-alanyl)
CYCLO(-GLU-GLU)
CAS:16691-00-2
Formula: C10H14N2O6
258.23
ACM16691002
CYCLO(-GLY-HIS)
CAS:15266-88-3
Formula: C8H10N4O2
194.19
ACM15266883
CYCLO(-GLY-L-GLU)
CAS:16364-35-5
Formula: C7H10N2O4
186.17
ACM16364355
AC1OLRHB, 3-[(2S)-3,6-dioxopiperazin-2-yl]propanoic Acid, CTK0H2040, AKOS006275240, AG-E-13510, 2-Piperazinepropanoicacid, 3,6-dioxo-, (S)-, 2-Piperazinepropanoicacid, 3,6-dioxo-, (2S)-, 16364-35-5
CYCLO(-GLY-PHE)
CAS:10125-07-2
Formula: C11H12N2O2
204.23
ACM10125072
CYCLO(-GLY-TRP)
CAS:7451-73-2
Formula: C13H13N3O2
243.26
ACM7451732
CYCLO(-LEU-PHE)
CAS:7280-77-5
Formula: C15H20N2O2
260.3
ACM7280775
CYCLO(-PHE-PHE)
CAS:2862-51-3
Formula: C18H18N2O2
294.35
ACM2862513
CYCLO(-SER-SER)
CAS:23409-30-5
Formula: C6H10N2O4
174.15
ACM23409305
CYCLO(-SER-TYR)
CAS:21754-31-4
Formula: C12H14N2O4
250.25
ACM21754314
CYCLO(-TRP-TRP)
CAS:20829-55-4
Formula: C22H20N4O2
372.42
ACM20829554
CYCLO(-TRP-TYR)
CAS:20829-53-2
Formula: C20H19N3O3
349.38
ACM20829532
CYCLO(.ALPHA.R)-.ALPHA.-HYDROXY-4-(4-MORPHOLINYL)BENZENEPROPANOYL-N-METHYL-L-LEUCYL-(2R)-2-HYDROXYPROPANOYL-N-METHYL-L-LEUCYL-(.ALPHA.R)-.ALPHA.-HYDROXY-4-(4-MORPHOLINYL)BENZENEPROPANOYL-N-METHYL-L-LEUCYL-(2R)-2-HYDROXYPROPANOYL-N-METHYL-L-LEUCYL
CAS:155030-63-0
Formula: C60H90N6O14
1119.4
ACM155030630
Cyclo(.alpha.R)-.alpha.-hydroxy-4-(4-morpholinyl)benzenepropanoyl-N-methyl-L-leucyl-(2R)-2-hydroxypropanoyl-N-methyl-L-leucyl-(.alpha.R)-.alpha.-hydroxy-4-(4-morpholinyl)benzenepropanoyl-N-methyl-L-leucyl-(2R)-2-hydroxypropanoyl-N-methyl-L-leucyl;Emodepsi
CYCLO(ARG-GLY-ASP-D-PHE-LYS)
CAS:161552-03-0
Formula: C27H41N9O7
603.67
ACM161552030
CYCLO(-RGDFK);CYCLO (ARG-GLY-ASP-D-PHE-LYS);cyclo (Arg-Gly-Asp-Phe-Lys);c(RGDfK);Cyclic RGDFK peptide;Cyclo(L-arginylglycyl-L-alpha-aspartyl-D-phenylalanyl-L-lysyl);Cyclo(-Arg-Gly-Asp-D-Phe-Lys)
Trifluoroacetate salt
CYCLO(ARG-GLY-ASP-D-PHE-VAL)
CAS:137813-35-5
Formula: C26H38N8O7
574.63
ACM137813355-1
CYCLO(D-TRP-LYS-THR-PHE-PRO-PHE)
CAS:102129-68-0
Formula: ClH
36.46094;g/mol
ACM102129680
CYCLO(D-TRP-LYS-THR-PHE-PRO-TYR)
CAS:102129-69-1
Formula: C44H54N8O8
822.94836;g/mol
ACM102129691
CYCLO-BIS(PARAQUAT-1,4-PHENYLENE)TETRAKIS(HEXAFLUOROPHOSPHATE)
CAS:117271-77-9
Formula: C36H32F24N4P4
1100.52
ACM117271779
CYCLO[2-METHYLALANYL-L-PHENYLALANYL-D-PROLYL-(AS,2S)-A-AMINO-H-OXO-2-OXIRANEOCTANOYL]
CAS:53342-16-8
Formula: C28H38N4O6
526.62
ACM53342168
CHLAMYDOCIN;2-Methylcyclo[Ala-L-Phe-D-Pro-6-[(S)-2-oxo-2-oxiranylethyl]-L-Nle-];Antibiotic SL-3440;SL-3440
CYCLOARTANE
CAS:511-64-8
Formula: C30H52
412.73
ACM511648
CYCLOARTANE;5a-Cycloartane;9,19-Cyclolanostane;Cycloorthane
CYCLOARTENOL
CAS:469-38-5
Formula: C30H50O
426.72
ACM469385
9,19-CYCLO-9BETA-LANOST-24-EN-3BETA-OL;9,19-CYCLO-9 BETA-LANOST-24-EN-3B-OL;24,(5-ALPHA)-CHOLESTEN-9-19-CYCLO-4,4,14-ALPHA-TRIMETHYL-3-BETA-OL;CYCLOARTENOL;CYCLOARTENOL(RG);9,19-Cyclolanost-24-en-3-ol;CYCLO-L-(L-PHE-L-PHE);9,19-Cyclolanosta-24-ene-3-ol
CYCLOARTENYL FERULATE
CAS:21238-33-5
Formula: C40H58O4
602.89
ACM21238335
19-Cyclolanost-24-en-3-ol,3-(4-hydroxy-3-methoxyphenyl)-2-propenoate,(3.beta.)-9;cycloartenolferulicacidester;CYCLOARTENYL FERULATE;(3beta)-9,19-cyclolanost-24-en-3-yl 4-hydroxy-3-methoxycinnamate;CYCLOARTENOLFERULATE;CYCLOARTENYL FERULATE STANDARD;3-(4-H
CYCLOASTRAGENOL
CAS:78574-94-4
Formula: C30H50O5
490.72
ACM78574944
(3beta,6alpha,16beta,20R,24S) 20,24-Epoxy-9,19-cyclolanostane-3,6,16,25-tetrol;Astramembrangenin;Cyclosieversigenin