Phone (USA) +1 212-348-5610
Whatsapp: +1 516-336-9307
WeChat: chembuyersguide
Chemical Search
 


























Alfa Chemistry




Country: USA

Alfa Chemistry
New York, USA


Phone: 201-478-8534
FAX: 516-927-0118
E-Mail:E-Mail this Supplier

Contact: Brenda Randy

https://www.alfa-chemistry.com/

Alfa Chemistry

Page: Home | 1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 |
 


Product List

TUNGSTEN OXIDE NANOWIRE
CAS:1314-35-8
Formula: O3W
231.8382
ACM1314358-1
Tungsten oxide, Tungstic oxide, Tungstic acid, Tungstic anhydride, Tungsten Blue, trioxotungsten, Tungsten(VI) oxide, TUNGSTEN TRIOXIDE, Tungstic acid anhydride, Tungsten oxide (WO3), Wolframic acid, anhydride, HSDB 5800, 204781_ALDRICH, 232785_ALDRICH, 5
TUNGSTEN SILICIDE
CAS:12039-88-2
Formula: Si2W
240.01
ACM12039882
TUNGSTEN SILICIDE;TUNGSTEN DISILICIDE;TUNGSTEN SILICIDE, -325 MESH;TUNGSTEN SILICIDE (99.7%-W);TUNGSTEN SILICIDE, 99.995% (METALS BASIS EXCLUDING MO), MO ;Tungsten silicide, 99.995% (metals basis excluding Mo), Mo ;Tungsten silicide, 99.5% (metals basis)
TUNGSTEN SILICIDE
CAS:12039-88-2
Formula: Si2W
240.01
ACM12039882
TUNGSTEN SILICIDE;TUNGSTEN DISILICIDE;TUNGSTEN SILICIDE, -325 MESH;TUNGSTEN SILICIDE (99.7%-W);TUNGSTEN SILICIDE, 99.995% (METALS BASIS EXCLUDING MO), MO ;Tungsten silicide, 99.995% (metals basis excluding Mo), Mo ;Tungsten silicide, 99.5% (metals basis)
TUNGSTEN SINGLE CRYSTAL DISC, 9MM (0.35IN) DIA, 2-3MM (0.08--0.1IN) THICK, (100) ORIENTATION, 0.5, ZONE REFINED
CAS:7440-33-7
ACM7440337-18
TUNGSTEN SINGLE CRYSTAL DISC, 9MM (0.35IN) DIA, 2-3MM (0.08--0.1IN) THICK, (110) ORIENTATION, 0.5, ZONE REFINED
CAS:7440-33-7
ACM7440337-20
TUNGSTEN SINGLE CRYSTAL, 8-9MM (0.31-0.35IN) DIA, 100MM (3.9IN) LONG, (110) ORIENTATION, 2, ZONE REFINED
CAS:7440-33-7
ACM7440337-5
TUNGSTEN SINGLE CRYSTAL, 8-9MM (0.31-0.35IN) DIA, 100MM (3.9IN) LONG, (111) ORIENTATION, 2, ZONE REFINED
CAS:7440-33-7
ACM7440337-3
TUNGSTEN SINGLE CRYSTAL, 8-9MM (0.31-0.35IN) DIA, 100MM (3.9IN) LONG, RANDOM ORIENTATION, ZONE REFINED
CAS:7440-33-7
ACM7440337-17
TUNGSTEN SULFIDE NANOPARTICLES
CAS:12138-09-9
Formula: WS2
247.97
ACM12138099-28
Tungsten disulphide
TUNGSTEN(IV) CHLORIDE
CAS:13470-13-8
Formula: WCl4;Cl4W;
325.64g/mol
ACM13470138
12795-66-3; AC1L3EXA; CTK0F6272; 13470-13-8; J-006593; WCl4;
TUNGSTEN(IV) OXIDE
CAS:12037-58-0
Formula: WO2.9
215.85
ACM12037580
TUNGSTEN(IV) OXIDE
CAS:12037-58-0
Formula: WO2.9
215.85
ACM12037580
TUNGSTEN(IV) OXIDE
CAS:12036-22-5
Formula: WO2;O2W;
215.838g/mol
ACM12036225
TRA0025192; Tungsten(IV) oxide, -100 mesh, 99.99% trace metals basis; Tungsten oxide (WO2); Tungsten(IV) oxide (99.9%-W); CTK3J1120; EC 234-842-7; 8922AF; I14-53780; AC1L348H; 12036-22-5;
TUNGSTEN(IV) SULFIDE
CAS:12138-09-9
Formula: WS2;S2W;
247.96g/mol
ACM12138099-2
AKOS015915933; Few Layers Nano WS2 Suspension 1 mg/mL(C: 1mg/ml, solvent: ethanol); NSC-326770; Tungstenite; Monotungsten disulfide; DTXSID2065256; AC1L34EN; TRA-0206786; AC1Q7EES; CHEBI:30521;
TUNGSTEN(V)CHLORIDE
CAS:13470-14-9
Formula: Cl5W
361.11
ACM13470149
TUNGSTEN (V) CHLORIDE;Wolfram(V) chloride;Wolfram(V)pentachloride;TUNGSTENPENTACHLORIDE
TUNGSTEN(V)DICHLORIDETRIETHOXIDE,10%W/VINETHANOL
CAS:45000-93-9
Formula: C6H15Cl2O3W
389.94
ACM45000939
Tungsten(V) dichloride triethoxide;
TUNGSTEN(V)ETHOXIDE
CAS:26143-11-3
Formula: C10H25O5W
409.14
ACM26143113
TUNGSTEN(V) ETHOXIDE, 26143-11-3, ACMC-1CBW9, CTK1A0041, AG-E-81472, TUNGSTEN(V) ETHOXIDE;TUNGSTEN PENTAETHOXIDE
TUNGSTEN(VI) CHLORIDE
CAS:13283-01-7
Formula: WCl6;Cl6W;
396.54g/mol
ACM13283017
Tungsten chloride, (OC-6-11)-; [WCl6]; RTR-004479; hexachloridotungsten; KSC491C2D; Tungsten(VI) chloride; Hexachlorotungsten; EINECS 236-293-9; CTK3J1121; ARONIS24089;
TUNGSTEN(VI) OXIDE NANOPARTICLES / NANOPOWDER
CAS:1314-35-8
Formula: WO3
231.84
ACM1314358-3
trioxotungsten
TUNGSTEN(VI) OXIDE NANOPARTICLES / NANOPOWDER
CAS:1314-35-8
Formula: WO3
231.84
ACM1314358-3
trioxotungsten
TUNGSTEN(VI) OXYCHLORIDE
CAS:13520-78-0
Formula: WOCl4
341.65
ACM13520780
TUNGSTEN OXYCHLORIDE;TUNGSTEN(VI) OXYCHLORIDE;tungsten tetrachloride oxide;TUNGSTEN OXIDE CHLORIDE;TUNGSTEN OXYCHLORIDE 99%;tungsten(vi) chloride oxide;Tungsten(VI)chlorideoxide,Tungsten(VI)oxidechloride;Tungsten chloride oxide(WCl4O)
TUNGSTEN(VI)ETHOXIDE
CAS:62571-53-3
Formula: C12H30O6W
454.2
ACM62571533
62571-53-3, ethanolate;tungsten, ACMC-20ajad, AGN-PC-00O5LC, Ethanol, tungsten(6+) salt, TUNGSTEN (VI) ETHOXIDE, CTK5B5320, AG-G-29969
TUNGSTEN(VI)ISOPROPOXIDE,5%W/VINISOPROPANOL
CAS:52321-90-1
Formula: C18H42O6W
538.38
ACM52321901
Tungsten(6+) hexa(2-propanolate);
TUNGSTIC ACID
CAS:7783-03-1
Formula: H2O4W
249.85
ACM7783031
(beta-4)-tungstate(wo42-dihydrogen;dihydrogen,(T-4)-Tungstate;O2W(OH)2;Orthotungstic acid;Tungstate (WO42-), dihydrogen, (T-4)-;Tungstate (WO42-), dihydrogen, (T-4)-;Tungstate,dihydrogen,(T-4)-;Tunstic acid
TUNICAMYCIN
CAS:11089-65-9
Formula: C37H60N4O16
816.89
ACM11089659
tunicamycin, Tunicamycin A1, CID5607, 11089-65-9
TUNICAMYCIN
CAS:11089-65-9
Formula: C37H60N4O16
816.89
ACM11089659
tunicamycin, Tunicamycin A1, CID5607, 11089-65-9
TURPENTINE,VENICE,SULFURIZED, GOLD SALT
CAS:91082-65-4
ACM91082654
TUTIN
CAS:2571-22-4
Formula: C15H18O6
294.30
ACM2571224
Tutu; Toot poison;
TWEEN 20
CAS:9005-64-5
Formula: C18H34O6
346.459991455078
ACM9005645
EMALEX ET-2020;FEMA 2915;PROTEIN SOLUBILIZER 20;POLYETHOXYETHANOL SORBITAN MONOLAUREATE;POLYETHYLENE GLYCOL SORBITAN MONOLAURATE;POLYOXYETHYLENE (4) SORBITAN MONOLAURATE;POLYOXYETHYLENE (20) SORBITAN MONOLAURATE;POLYOXYETHYLENE (20) MONOLAURATE
TWEEN 60
CAS:9005-67-8
Formula: C64H126O26
ACM9005678
POLYETHYLENE GLYCOL SORBITAN MONOSTEARATE;POLYSORBATE 61;POLYSORBATUM 60;POLYSORBATE 60;POLYOXYETHYLENE SORBITAN MONOSTEARATE;POLYOXYETHYLENE (20) SORBITAN MONOSTEARATE;POLYOXYETHYLENE(20) SORBITAN MONOISOSTEARATE;POLYOXYETHYLENE (4) SORBITAN MONOSTEARATE
TWEEN 80
CAS:9005-65-6
ACM9005656
TWEEN 85
CAS:9005-70-3
ACM9005703
TXO-PHCZ
CAS:1623010-64-9
ACM1623010649
TXO-TPA
CAS:1623010-63-8
ACM1623010638
TYLOPHORINE
CAS:111408-21-0
Formula: C24H27NO4
393.48
ACM111408210
TYLOSIN TARTRATE
CAS:1405-54-5
Formula: C49H81NO23
1052.16
ACM1405545
TYLOSIN TARTRATE SALT;TYLOSINE TARTRATE;pharmasin;Tylosin, [R-(R*,R*)]-2,3-dihydroxybutanedioate (salt) ;Tylosin, (2R,3R)-2,3-dihydroxybutanedioate (salt);TYLOSINTARTRATE,BP;Tylosin tartrate;TYLOSINTARTRATEPOWDER/GRANULAR
TYLOSIN,3-ACETATE 4B-(3-METHYLBUTANOATE)
CAS:63409-12-1
Formula: C53H87NO19
1042.26
ACM63409121
Tylosin, 3-acetate 4B-(3-methylbutanoate);3-acetyl-4-isovaleryltylosin;ACETYLISOVALERYLTYLOSIN;TYLVALOSIN;3-O-Acetyl-4-O-isovaleryltylosin;Tyrosine [antibiotic]3-acetate 4-(3-methylbutanoate)
TYLOSIN,3-ACETATE 4B-(3-METHYLBUTANOATE)
CAS:63409-12-1
Formula: C53H87NO19
1042.26
ACM63409121
Tylosin, 3-acetate 4B-(3-methylbutanoate);3-acetyl-4-isovaleryltylosin;ACETYLISOVALERYLTYLOSIN;TYLVALOSIN;3-O-Acetyl-4-O-isovaleryltylosin;Tyrosine [antibiotic]3-acetate 4-(3-methylbutanoate)
TYR-C-PEPTIDE HUMAN
CAS:139532-11-9
Formula: C162H268N50O54
3780.16
ACM139532119
TYR-CORTICOTROPIN RELEASING FACTOR HUMAN, RAT
CAS:100915-92-2
ACM100915922
YSEEPPISLDLTFHLLREVLEEMARAEQLAQQAHSNRKLMEII-NH2;TYROSYL-CORTICOTROPIN RELEASING FACTOR (HUMAN, RAT);TYROSYL-CRF (HUMAN, RAT);TYR-SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-H
TYR-D-ALA-P-CHLORO-PHE-PRO-NH2
CAS:102029-97-0
Formula: C26H32ClN5O5
530.02
ACM102029970
[D-ALA2, P-CHLORO-PHE3]-BETA-CASOMORPHIN (1-4) AMIDE (BOVINE);[DALA2, (PCL)PHE3] BETA-CASOMORPHIN, AMIDE, BOVINE;TYR-D-ALA-P-CHLORO-PHE-PRO-NH2;TYR-DALA-(PCL)PHE-PRO-NH2;B-CASOMORPHIN (D-ALA2,PCL-PHE3)-FRAGMENT 1-4 AMIDE;[D-Ala2, p-Cl-Phe3]--Casomorph
TYRAMINE
CAS:51-67-2
Formula: C8H11NO
137.2
ACM51672
2-(4-Hydroxyphenyl)ethylamine , 4-(2-Aminoethyl)phenol , 4-Hydroxyphenethylamine , NSC 249188 , p-Tyramine , Uteramine
TYROSINASE
CAS:9002-10-2
ACM9002102
TYROSINE,N-(2-AMINOBUTYRYL)-(6CI)
CAS:101265-94-5
Formula: C13H18N2O4
266.29
ACM101265945
H-2-ABU-TYR-OH;H-ABU-TYR-OH;L-2-AMINO-N-BUTYRIC ACID TYROSINE
TYROTHRICIN
CAS:1404-88-2
Formula: C6H13NO5
179.17112
ACM1404882
bactratycin;coltirot;dermotricine;duboscrudecrystals;hydrotricine;intradermtyrothricin;martricin;soluthricin
TYRPHOSTIN 51
CAS:126433-07-6
Formula: C13H8N4O3
268.23
ACM126433076
TYRPHOSTIN AG 1112
CAS:153150-84-6
Formula: C15H10N6
274.28
ACM153150846
TYRPHOSTIN AG 528
CAS:133550-49-9
Formula: C18H14N2O3
306.32
ACM133550499
Tyrphostin AG 528, AC1NKF00, CTK8E9286, 133550-49-9, MCULE-5668494700, 2-(2,3-dihydroindole-1-carbonyl)-3-(3,4-dihydroxyphenyl)prop-2-enenitrile, (2E)-2-(2,3-dihydro-1H-indol-1-ylcarbonyl)-3-(3,4-dihydroxyphenyl)prop-2-enenitrile, (2Z)-2-(2,3-dihydro-1H-i
TYRPHOSTIN B44
CAS:133550-32-0
Formula: C18H16N2O3
308.33
ACM133550320
TYZOR(TM)ZEC ORGANIC ZIRCONATE
CAS:308847-92-9
Formula: C26H44O16Zr
703.84
ACM308847929
TYZOR(TM) ZEC ORGANIC ZIRCONATE;ZIRCONIUM(IV) BIS(DIETHYL CITRATO)DIPROPOXIDE;ZIRCONIUM BIS(DIETHYLCITRATO)DI-N-PROPOXIDE;tyzor zec organic zirconate;ZIRCONIUM BIS(DIETHYLCITRATO)DI-n-PROPOXIDE, 75% in n-propanol/ethanol;TYZOR(R)ZECorganiczirconate;Zircon
U 18666A
CAS:3039-71-2
Formula: C25H42ClNO2
424.06
ACM3039712
U 18666A;3BETA-(2-DIETHYLAMINOETHOXY)ANDROST-5-EN-17 ONE, HCL;3BETA-(2-DIETHYLAMINOETHOXY)-ANDROSTENONE HCL;3BETA-(2-DIETHYLAMINO-ETHOXY)ANDROSTENONE HYDROCHLORIDE;(3BETA)-3-[2-(DIETHYLAMINO)ETHOXY]ANDROST-5-EN-17-ONE DIHYDROCHLORIDE;(3B)-3-[2-(DIETHYLAMI
U-46619
CAS:56985-40-1
Formula: C21H34O4
350.49
ACM56985401
C21H34O4, CID6434544, LS-74665, U46619, U 46619, 9a,11a-Methanoepoxy-15-hydroxyprosta-5,13-dienoic acid, 1R-(1alpha,4alpha,5beta(Z),6alpha(1E,3S*)))-isomer, 5-Heptenoic acid, 7-(6-(3-hydroxy-1-octenyl)-2-oxabicyclo(2.2.1)hept-5-yl)-, (1R-(1-alpha,4-alpha,
U-69593
CAS:96744-75-1
Formula: C22H32N2O2
356.5
ACM96744751
U-71184
CAS:101222-80-4
Formula: C30H23N5O3
501.54
ACM101222804
U0124
CAS:108923-79-1
Formula: C8H10N4S2
226.32
ACM108923791
UBENIMEX
CAS:58970-76-6
Formula: C16H24N2O4
308.37
ACM58970766
3-(r)-amino-2-(s)-hydroxy-4-phenylbutanoyl-(s)-leucine;n-(3-amino-2-hydroxy-1-oxo-4-phenylbutyl)-,(s-(r*,s*))-l-leucin;nk421;UBENIMEX;N-[(2S,3R)-3-AMINO-2-HYDROXY-1-OXO-4-PHENYLBUTYL]-L-LEUCINE;N-((2S,3R)-3-AMINO-2-HYDROXY-4-PHENYLBUTYRYL)-L-LEUCINE;[(2S,
UBENIMEX
CAS:58970-76-6
Formula: C16H24N2O4
308.37
ACM58970766
3-(r)-amino-2-(s)-hydroxy-4-phenylbutanoyl-(s)-leucine;n-(3-amino-2-hydroxy-1-oxo-4-phenylbutyl)-,(s-(r*,s*))-l-leucin;nk421;UBENIMEX;N-[(2S,3R)-3-AMINO-2-HYDROXY-1-OXO-4-PHENYLBUTYL]-L-LEUCINE;N-((2S,3R)-3-AMINO-2-HYDROXY-4-PHENYLBUTYRYL)-L-LEUCINE;[(2S,
UBIQUINONE
CAS:10303-98-0
ACM10303980
UBIQUITIN
CAS:79586-22-4
ACM79586224
UBP302
CAS:745055-91-8
Formula: C15H15N3O6
333.30
ACM745055918
Tocris-2079; UBC; (S)-1-(2-AMINO-2-CARBOXYETHYL)-3-(2-CARBOXYBENZYL)PYRIMIDINE-2,4-DIONE; UBP-302; 2f35;
UCL 1684 DITRIFLUOROACETATE HYDRATE
CAS:201147-19-5
Formula: C38H30F6N4O4??xH2O
720.66 (anhydrous ba
ACM201147195
UCL 2077
CAS:918311-87-2
Formula: C25H22N2
350.46
ACM918311872
UCL 2077, 918311-87-2, CTK8E6938, HMS3261B11, HMS3269L03, (3-Triphenylmethylaminomethyl)pyridine, CCG-221789, LP00485, NCGC00167818-01, NCGC00167818-02, BRD-K50325075-001-01-3
UCL-1848 TRIFLUOROACETATE SALT
CAS:201147-53-7
Formula: C32H34F6N4O4??xC2HF3O2
652.63 (free base ba
ACM201147537
UCPH 101
CAS:1118460-77-7
Formula: C27H22N2O3
C27H22N2O3
ACM1118460777
UCPH 101;
UGH-1
CAS:18849-24-6
ACM18849246
UGH-2
CAS:40491-34-7
ACM40491347
ULEXITE
CAS:1319-33-1
ACM1319331
Ulexite;Ulexite (CaNaH12(BO3)5.2H2O);sodium calcium borate
ULIPRISTAL ACETATE
CAS:126784-99-4
Formula: C30H37NO4
475.62
ACM126784994
Ulipristal acetate; [(8S,11R,13S,14S,17R)-17-acetyl-11-[4-(dimethylamino)phenyl]-13-methyl-3-oxo-1,2,6,7,8,11,12,14,15,16-decahydrocyclopenta[a]phenanthren-17-yl] acetate; Ella; VA2914;
ULTRAPURE SHORT SWCNTS AQUEOUS DISPERSION
CAS:1333-86-4
ACM1333864-66
ULTRAPURE SWCNTS AQUEOUS DISPERSION
CAS:1333-86-4
ACM1333864-84
ULTRAVIOLET ABSORBENT UV-1164
CAS:2725-22-6
Formula: C33H39N3O2
509.68166
ACM2725226
2-(4,6-Bis-(2,4-dimethylphenyl)-1,3,5-triazin-2-yl)-5-(octyloxy)-phenol;UV-1164;Ultraviolet Absorbent UV-1164;UV ABSORBER-1164;Phenol, 2-4,6-bis(2,4-dimethylphenyl)-1,3,5-triazin-2-yl-5-(octyloxy)-;2,4-BIS(2,4-DIMETHYLPHENYL)-6-(2-HYDROXY-4-N-OCTYLOXYPHEN
ULTRAVIOLET ABSORBENT UV-P
CAS:2440-22-4
Formula: C13H11N3O
225.25
ACM2440224
ULTRAVIOLET ABSORBENTUV-360
CAS:103597-45-1
Formula: C41H50N6O2
658.87
ACM103597451
2,2-METHYLENEBIS[6-(2H-BENZOTRIAZOL-2-YL)-4-(1,1,3,3-TETRAMETHYLBUTYL)PHENOL];2,2-METHYLENEBIS[6-(BENZOTRIAZOL-2-YL)-4-TERT-OCTYLPHENOL];BIS[3-(BENZOTRIAZOL-2-YL)-2-HYDROXY-5-TERT-OCTYLPHENYL]METHANE;2,2-methylenebis(6-(2H-benzotriazol-2-yl) -4-(1,;Methyl
UMCKALIN
CAS:43053-62-9
Formula: C11H10O5
0
ACM43053629
UMCKALIN;5,6-Dimethoxy-7-hydroxy-2H-1-benzopyran-2-one;7-Hydroxy-5,6-dimethoxy-2H-1-benzopyran-2-one;Umckaline;2H-1-Benzopyran-2-one, 7-hydroxy-5,6-dimethoxy-;UMCKALIN(SH);5-Methoxyscopoletin;7-Hydroxy-5,6-dimethoxycoumarin
UMICORE METAL PRECURSORS KIT
ACM-00013585
UNCARINE F
CAS:14019-66-0
Formula: C21H24N2O4
368.426260 [g/mol]
ACM14019660
Uncarine F, 14019-66-0, C17598
UNDECA-1,5-DIYNE
CAS:10160-98-2
Formula: C11H16
148.244740 [g/mol]
ACM10160982
Undeca-1,5-diyne, 10160-98-2, 1,5-Undecadiyne, CTK0H1725, AKOS006239529, AG-D-08764
UNDECAETHYLENE GLYCOL
CAS:6809-70-7
Formula: C22H46O12
502.59
ACM6809707
UNDECANE
CAS:1120-21-4
Formula: C10H19KO2
156.31
ACM1120214
UNDECANE
CAS:1120-21-4
Formula: C10H19KO2
156.31
ACM1120214
UNDECANE,3-METHYL-
CAS:1002-43-3
Formula: C12H26
170.3348
ACM1002433
3-METHYLHENDECANE;3-METHYLUNDECANE;98%;methylundecane;undecane,3-methyl-;3-METHYLUNDECANE 98+%
UNDECANEDIOIC ACID
CAS:1852-04-6
Formula: C11H20O4
216.27
ACM1852046
Undecanedionic acid;RARECHEM AL BO 0436;NONAMETHYLENEDICARBOXYLIC ACID;UNDECANEDIOIC ACID;1,11-UNDECANEDIOIC ACID;1,9-NONAMETHYLENE DICARBOXYLIC ACID;1,9-NONANEDICARBOXYLIC ACID;HENDECANEDIOIC ACID
UNDECANOIC ACID
CAS:112-37-8
Formula: C11H22O2
186.29
ACM112378
Hendecanoic acid
UNDECANOL
CAS:112-42-5
Formula: C11H24O
172.30
ACM112425
1-Hendecanol
UNDECYL 2-ACETAMIDO-2-DEOXY-3,4,6-TRI-O-ACETYL-BETA-D-GLUCOPYRANOSIDE
CAS:173725-24-1
Formula: C25H43NO9
501.613
ACM173725241
UNDECYL ACETATE
CAS:1731-81-3
Formula: C13H26O2
214.34
ACM1731813
N-undecyl acetate
UNDECYL ACETATE
CAS:1731-81-3
Formula: C13H26O2
214.34
ACM1731813
N-undecyl acetate
UNDECYL DODECYL PHTHALATE,MW 502(185CS(25C))
CAS:68515-47-9
502
ACM68515479-1
UNDECYL ISOCYANATE,98%
CAS:2411-58-7
Formula: C12H23NO
197.32
ACM2411587
Undecyl isocyanate, 1-isocyanatoundecane, 478466_ALDRICH, MolPort-003-934-323, NSC508828, CID350245, S14-1333, 2411-58-7
UNDECYL METHANE SULFATE
Formula: C12H26O3S
250.4
ACM-00003908
UNDECYLAMINE
CAS:7307-55-3
Formula: C11H25N
171.32
ACM7307553
UNDECYLENOYL PHENYLALANINE
CAS:175357-18-3
Formula: C20H29NO3
331.44916
ACM175357183
UNDECYLENOYL PHENYLALANINE;N-(1-Oxo-10-undecen-1-yl)-L-phenylalanine;L-Phenylalanine, N-(1-oxo-10-undecen-1-yl)-
UNDECYLTRICHLOROSILANE
CAS:18052-07-8
Formula: C11H23Cl3Si
289.74
ACM18052078
UNDECYLTRICHLOROSILANE, AKOS015914763, I14-41306, 18052-07-8
UNDECYLTRICHLOROSILANE
CAS:18052-07-8
Formula: C11H23Cl3Si
289.74
ACM18052078
UNDECYLTRICHLOROSILANE, AKOS015914763, I14-41306, 18052-07-8
UNGEREMINE
CAS:2121-12-2
Formula: C16H12NO3
266.275
ACM2121122
ungeremine;[1,3]Dioxolo[4,5-j]pyrrolo[3,2,1-de]phenanthridinium, 4,5-dihydro-2-hydroxy-;Ungerimine;C12189
UNICONAZOLE
CAS:83657-22-1
Formula: C15H18ClN3O
291.78
ACM83657221
SUMAGIC;SUMISEVEN;UNICONAZOLE;UNICONAZOLE-P;(e)-(+-)-ylethyl);(e)-1-(4-chlorophenyl)-4,4-dimethyl-2-(1,2,4-triazol-1-yl)-1-penten-3-ol;beta-((4-chlorophenyl)methylene)-alpha-(1,1-dimethylethyl)-(e)-(+-)-1h-4-triazole-1-ethanol;m13144
UNICONAZOLE
CAS:83657-17-4
Formula: C15H18ClN3O
291.78
ACM83657174
LOMICA;SUMISEVEN;SUMAGIC;(e)-(+)-(s)-1-(4-chlorophenyl)-4,4-dimethyl-2-(1,2,4-triazol-1-yl)-pent-1-en;(s-(e))-ylethyl);(s)-s3307;(s)-uniconazole;beta-((4-chlorophenyl)methylene)-alpha-(1,1-dimethylethyl)-(s-(e))-1h-4-triazole-1-ethanol
UNIFIRAM
CAS:272786-64-8
Formula: C13H15FN2O3S
298.3332032
ACM272786648
UnifiraM;2-[(4-Fluorophenyl)sulfonyl]hexahydropyrrolo[1,2-a]pyrazin-6(2H)-one;(8aR)-2-[(4-fluorophenyl)sulfonyl]hexahydropyrrolo[1,2-a]pyrazin-6(2H)-one
UNIVERSAL
CAS:102962-70-9
ACM102962709
UPCONVERTING NANOPARTICLES (BLUE LIGHT)
ACM-00000380
UPCONVERTING NANOPARTICLES (GREEN LIGHT)
ACM-00000298
UPCONVERTING NANOPARTICLES (NEAR-INFRARED LIGHT)
ACM-00000418
UPCONVERTING NANOPARTICLES (RED LIGHT)
ACM-00000297
UPCONVERTING NANOPARTICLES (UV LIGHT)
ACM-00000384
UR-AK57 DIHYDROCHLORIDE
CAS:902154-35-2
392.37
ACM902154352
URACIL-5-CARBOXYLIC ACID MONOHYDRATE
CAS:69727-34-0
Formula: C5H6N2O5
174.11
ACM69727340
URACIL-D4
CAS:24897-55-0
Formula: C4D4N2O2
116.11
ACM24897550
URACIL-D4
URAMIL-N,N-DIACETIC ACID
CAS:13055-06-6
Formula: C8H9N3O7
259.17
ACM13055066
URANIUM(VI)OXIDE
CAS:1344-58-7
Formula: O3U
286.03
ACM1344587
URANIUM TRIOXIDE;URANIUM(VI) OXIDE;URANIUM OXIDE YELLOW;UO3;Uranium oxide (UO3);Uranium(VI) oxide, red;URANIUM (VI) OXIDE 99.8%;triketouranium
URANIUM, BIS(NITRATO-KO)DIOXO-, HYDRATE (1:6), (T-4)-(9CI)
CAS:13520-83-7
Formula: H2O . 1/6 N2 O8 U
502.14
ACM13520837
URANIUM NITRATE;URANIUM NITRATE, HEXAHYDRATE;URANYL DINITRATE HEXAHYDRATE;URANYL NITRATE HEXAHYDRATE;URANYL NITRATE HYDRATE;bis(nitrato)dioxo-uraniuhexahydrate;dinitratodioxo-uraniuhexahydrate;hexahydrate(t-4)-uraniu
URAPIDIL HYDROCHLORIDE
CAS:64887-14-5
Formula: C20H30ClN5O3
423.94
ACM64887145
6[[3-[4-(O-METHOXYPHENYL)-1-PIPERAZINYL]PROPYL]AMINO]-1,3-DIMETHYLURACIL HYDROCHLORIDE;6-[[3-[4-(2-METHOXYPHENYL)-1-PIPERAZINYL]PROPYL]AMINO]-1,3-DIMETHYL-2,4(1H,3H)-PYRIMIDINEDIONE;6-[[3-[4-(2-METHOXYPHENYL)-1-PIPERAZINYL]PROPYL]AMINO]-1,3-DIMETHYL-2,4(1
UREA
CAS:506-89-8
Formula: CH4N2O
60.06
ACM506898
UREA, PRILLED;UREA HYDROCHLORIDE;UREA FERTILIZER;UREUM;AKOS BBS-00004448;CARBONYLDIAMIDE;CARBIMIDE;HARNSTOFF
UREA
CAS:57-13-6
Formula: CH4N2O
60.06
ACM57136
UREA;UREA HYDROCHLORIDE;UREA, PRILLED;UREA FERTILIZER;UREUM;(NH2)2CO;ai3-01202;Alphadrate
UREA HYDROGEN PEROXIDE
CAS:124-43-6
Formula: CO(NH2)2H2O2
94.07
ACM124436
Urea Hydrogen Peroxide; hydrogen peroxide,urea; Hydrogen peroxideUrea adduct; Ureahydrogenperoxide; Urea hydrogen peroxide;
UREA PHOSPHATE
CAS:4401-74-5
Formula: CH4N2O.xH3O4P
158.050441 g/mol
ACM4401745
C 904;C 904 (Flame retardant);Carbamido-orthophosphat;Carbamido-orthophosphat [german];Einecs 224-534-0
UREA(13C,15N2)
CAS:58069-83-3
Formula: CH4N2O
63.08
ACM58069833
UREA (13C, 15N2);UREA-13C-15N2, 99 ATOM % 13C, 99 ATOM % 15N
UREA,(4-ACETYL-1H-1,2,3-TRIAZOL-1-YL)-(9CI)
CAS:177084-94-5
Formula: C5H7N5O2
169.14138
ACM177084945
UREA,CLINICAL DETECTION,NONFERMENT BACTERIA
CAS:100078-01-1
ACM100078011
UREA,N,N''-(METHYLENEDI-4,1-PHENYLENE)BIS[N',N'-DIMETHYL-
CAS:10097-09-3
Formula: C19H24N4O2
340.42
ACM10097093
4,4'-METHYLENE BIS PHENYLDIMETHYL UREA;Urea, N,N-(methylenedi-4,1-phenylene)bisN,N-dimethyl-;N,N''-(methylenedi-4,1-phenylene)bis[N',N'-dimethyl urea];4,4'-Methylenebis(1,1-dimethyl-3-phenylurea)
UREA,N,N'-BIS[3-(DIMETHYLAMINO)PROPYL]-
CAS:52338-87-1
Formula: C11H26N4O
230.3503
ACM52338871
1,3-bis[3-(dimethylamino)propyl]urea;Urea, N,N-bis3-(dimethylamino)propyl-;1,3-Bis[3-(dimethylamino)propyl]harnstoff;N,N'-Bis[3-(dimethylamino)propyl]urea;Einecs 257-861-2
UREA,N-(4-AMINOPHENYL)-N'-PHENYL-
CAS:10141-46-5
Formula: C13H13N3O
227.26
ACM10141465
UREA,N-CYANO-
CAS:2208-89-1
Formula: C2H3N3O
85.06472
ACM2208891
UREA-D4
CAS:1433-11-0
Formula: CD4N2O
64.08
ACM1433110
URIDINE 5'-MONOPHOSPHATE
CAS:58-97-7
Formula: C9H13N2O9P
324.18
ACM58977
URIDINE 5'-MONOPHOSPHOMORPHOLIDATE 4-MORPHOLINE-N,N'-DICYCLOHEXYLCARBOXAMIDINE SALT
CAS:24558-91-6
Formula: NULL
686.7300
ACM24558916
URIDINE 5-DIPHOSPHOGLUCOSE DISODIUM SALT
CAS:28053-08-9
Formula: C15H22N2Na2O17P2
610.27
ACM28053089
URIDINE-5-DIPHOSPHOGLUCOSE DISODIUM;P1-uridine-5 P2-glucose-1 disodium pyrophosphate;uridine(5)disodiodiphospho(1)-alpha-D-glucose;uridine 5-diphosphoglucose disodium salt from saccharomyces cerevisiae;Uridine-5-diphospho-D-glucose disodium salt;UDP-glc;U
URIDINE 5-DIPHOSPHOGLUCURONIC ACID AMMONIUM SALT
CAS:43195-60-4
Formula: C15H25N3O18P2
580.29 (free acid basis)
ACM43195604
UDP-GlcA, Uridine-diphosphate-glucuronic acid ammonium salt, Uridine 5 inverted exclamation marka-diphosphoglucuronic acid ammonium salt, Uridine[5 inverted exclamation marka]diphospho[1]-|A-D-glucopyranosuronic acid ammonium salt, 43195-60-4
URIDINE 5-DIPHOSPHOHEXANOLAMINE SODIUM SALT
CAS:108320-83-8
525.32
ACM108320838
URIDINE 5-TRIPHOSPHATE TRIS TYPE VI
CAS:108321-53-5
Formula: C9H15N2O15P3
484.14
ACM108321535
(2R,5S)-2-(2,4-Dioxo-3,4-dihydro-1(2H)-pyrimidinyl)-5-({[hydroxy( {hydroxy[(oxophosphino)oxy]phosphoryl}oxy)phosphoryl]oxy}methyl)t etrahydrofuran-3,4-diyl;
URIDINE, 2-THIO-
CAS:20235-78-3
Formula: C9H12 N2 O5 S
260.267
ACM20235783
2-thiouridine, Uridine, 2-thio-, CID3036443, A3104/0131463, 20235-78-3, s2U
URIDINE, CYCLIC2',3'-(HYDROGEN PHOSPHATE), MONOSODIUM SALT (9CI)
CAS:15718-50-0
Formula: C9H11 N2 O8 P . Na
306.166
ACM15718500
2',3'-CUMP SODIUM SALT;URIDINE-2',3'-CYCLIC MONOPHOSPHATE SODIUM SALT;uridine-2',3'-cyclicmonophosphate(2',3'-cump),sodiumsalt;uridine2':3'-cyclicmonophosphate*sodium;Uridine, cyclic 2',3'-(hydrogen phosphate), monosodium salt;Uridine 2',3'-(phosphoric a
URIDINE,5'-O-[BIS(4-METHOXYPHENYL)PHENYLMETHYL]-2'-DEOXY-5-[3-OXO-3-[[2-[(TRIFLUOROACETYL)AMINO]ETHYL]AMINO]-1-PROPENYL]-,3'-[2-CYANOETHYL BIS(1-METHYLETHYL)PHOSPHORAMIDITE](9CI)
CAS:153512-22-2
Formula: C46H54F3N6O10P
938.92
ACM153512222
AMINO-MODIFIER-C 2-DT CEP
URIDINE-3,5-CYCLIC MONOPHOSPHATE SODIUM SALT
CAS:56632-58-7
Formula: C9H10N2NaO8P
328.15
ACM56632587
URIDINE 3:5-CYCLIC MONOPHOSPHATE SODIUM SALT;URIDINE-3,5-CYCLIC MONOPHOSPHATE SODIUM SALT;uridine-3',5'-cyclicmonophosphate(cump),sodiumsalt;uridine3':5'-cyclicmonophosphate*sodium;CUMP SODIUM SALT;Uridine, cyclic 3,5-(hydrogen phosphate), monosodium salt
URIDINE-3,5-CYCLIC MONOPHOSPHATE SODIUM SALT
CAS:56632-58-7
Formula: C9H10N2NaO8P
328.15
ACM56632587
URIDINE 3:5-CYCLIC MONOPHOSPHATE SODIUM SALT;URIDINE-3,5-CYCLIC MONOPHOSPHATE SODIUM SALT;uridine-3',5'-cyclicmonophosphate(cump),sodiumsalt;uridine3':5'-cyclicmonophosphate*sodium;CUMP SODIUM SALT;Uridine, cyclic 3,5-(hydrogen phosphate), monosodium salt
URIDINE-5'-TRIPHOSPHATE TRISODIUM SALT DIHYDRATE
CAS:116295-90-0
Formula: C9H16N2Na3O17P3
586.1144
ACM116295900
116295-90-0, Uridine-5-triphosphate trisodium salt dihydrate
URIDINE-5-DIPHOSPHOGLUCOSE DISODIUM SALT
CAS:27821-45-0
Formula: C15H24N2Na2O18P2
628.28
ACM27821450
UDP 2NA;URIDINE 5-DIPHOSPHATE DISODIUM SALT;URIDINE 5-DIPHOSPHORIC ACID DISODIUM SALT;5-UDP-Na2
;Uridine 5-(trihydrogen diphosphate), disodium salt ;UDP(URIDINE-5-DIPHOSPHATE);URIDINE-5- DIPHOSPHATE, DISODIUM SALT(UDP.NA2);Uridine-5-diphosphoglucose d
URIDINE-5-DIPHOSPHOGLUCOSE PYROPHOSPHORYLASE FROM BAKER'S YEAST
CAS:9026-22-6
ACM9026226
URIDINE5'-(TETRAHYDROGEN TRIPHOSPHATE), 5-BROMO-2'-DEOXY-, TETRASODIUM SALT (9CI)
CAS:102212-99-7
Formula: C9H14 Br N2 O14 P3 . 4 Na
547.04
ACM102212997
URIDINE5'-(TETRAHYDROGEN TRIPHOSPHATE),5-(3-AMINO-1-PROPENYL)-2'-DEOXY-,TETRAAMMONIUM SALT(9CI)
CAS:109921-28-0
Formula: C12H20N3O14P3.4H3N
589.17
ACM109921280
5-(3-AMINOALLYL)-2'-DEOXY-URIDINE 5'-TRIPHOSPHATE SODIUM SALT;AMINOALLYL-DUTP SODIUM SALT;AA-DUTP SODIUM SALT;5-(3-aminoallyl)-2'-deoxyuridine*5'-triphosphate;AMINOALLYL-DUTP SODIUM SALT READY MADE;5-(3-AMINOALLYL)-2'-DEOXYURIDINE5'-TRIPH OSPHATE SO;5-(
URIDYLIC ACID
CAS:84-53-7
Formula: C18H26N4O18P2
648.36
ACM84537
URIDINE-2'(3')-MONOPHOSPHATE;URIDINE-2'(3)-MONOPHOSPHATE;URIDYLIC ACID;uridine 3'-(dihydrogen phosphate);Uridylic acid (2? and 3? mixture);3'-uridylic acid;3'-UMP;3'-Uridine monophosphate
URIDYLYL(2'->5')URIDINE AMMONIUM SALT
CAS:108321-54-6
Formula: C18H26N5O14P
567.4
ACM108321546
108321-54-6, Uridylyl(2 inverted exclamation marka inverted exclamation marku5 inverted exclamation marka)uridine ammonium salt
URIDYLYL-(5'->3')-INOSINE
CAS:10021-57-5
Formula: C19H23N6O13P
ACM10021575
UROCANIC ACID
CAS:104-98-3
Formula: C6H6N2O2
138.13
ACM104983
UROLITHIN A
CAS:1143-70-0
Formula: C13H8O4
228.20
ACM1143700
3,8-dihydroxy-6H-benzo[c]chromen-6-one
UROLITHIN A 8-METHYL ETHER
CAS:35233-17-1
Formula: C14H10O4
242.23
ACM35233171
3-Hydroxy-8-methoxy-6H-benzo[c]chromen-6-one
UROPORPHYRIN I DIHYDROCHLORIDE
CAS:68929-06-6
Formula: C40H40Cl2N4O16
903.67
ACM68929066
UroporphyrinIdihydrochloride; 21H,23H-Porphine-2,7,12,17-tetrapropanoic acid, 3,8,13,18-tetrakis(carboxymethyl)-, hydrochloride (1:2); 3-[7,12,17-tris(2-carboxyethyl)-3,8,13,18-tetrakis(carboxymethyl)-21,22-dihydroporphyrin-2-yl]propanoic acid dihydrochlo
UROPORPHYRIN I ETHYL ESTER FROM BOVINE PORPHYRIC URINE
CAS:54090-85-6
Formula: C48H54N4O16;
942.972g/mol
ACM54090856
UROPORPHYRIN I ETHYL ESTER;54090-85-6;DTXSID80657576;FT-0750997;C-55043;Uroporphyrin I ethyl ester from bovine porphyric urine;2,2',2'',2'''-[3,8,13,18-Tetrakis(3-ethoxy-3-oxopropyl)porphyrin-2,7,12,17-tetrayl]tetraacetic acid;21H,23H-Porphine-2,7,12,17-t
UROPORPHYRIN I,OCTAMETHYL ESTER
CAS:10170-03-3
Formula: C48H54N4O16
942.96
ACM10170033
Uroporphyrin I octamethyl ester, U3253_ALDRICH, U3253_SIGMA, CID66288, NSC89197, EINECS 233-444-0, NSC 89197, 10170-03-3, 21H,23H-Porphine-2,7,12,17-tetrapropanoic acid, 3,8,13,18-tetrakis(2-methoxy-2-oxoethyl)-, tetramethyl ester, 21H,23H-Porphine-2,7,12
UROPORPHYRIN III OCTAMETHYL ESTER
CAS:15435-60-6
Formula: C48H54N4O16
942.96
ACM15435606
CID85842, EINECS 239-447-3, Tetramethyl 3,8,13,17-tetrakis(2-methoxy-2-oxoethyl)-21H,23H-porphine-2,7,12,18-tetrapropionate, 15435-60-6, 21H,23H-Porphine-2,7,12,18-tetrapropanoic acid, 3,8,13,17-tetrakis(2-methoxy-2-oxoethyl)-, 2,7,12,18-tetramethyl ester
UROPORPHYRINOGEN III
CAS:1976-85-8
Formula: C40H44N4O16
0
ACM1976858
Uroporphyrinogen III;2,7,12,18-Tetrakis(2-oxo-2-hydroxyethyl)-3,8,13,17-tetrakis(3-oxo-3-hydroxypropyl)-5,10,15,20,22,24-hexahydro-21H,23H-porphyrin;5,10,15,20,22,24-Hexahydrouroporphyrin III
URSODEOXYCHOLIC ACID
CAS:128-13-2
Formula: C24H40O4
392.57
ACM128132
3a,7-Dihydroxy-6-cholan-24-oic acid; 3,7-Dihydroxycholan-24-oic acid; 3alpha,7beta-Dihydroxy-6beta-cholan-24-oic acid; Ursodiol;
URSODEOXYCHOLIC ACID
CAS:128-13-2
Formula: C24H40O4
392.57
ACM128132
3a,7-Dihydroxy-6-cholan-24-oic acid; 3,7-Dihydroxycholan-24-oic acid; 3alpha,7beta-Dihydroxy-6beta-cholan-24-oic acid; Ursodiol;
URSOLIC ACID
CAS:77-52-1
Formula: C30H48O8
456.71
ACM77521
URSOLIC ACID
CAS:77-52-1
Formula: C30H48O8
456.71
ACM77521
URSONIC ACID
CAS:6246-46-4
Formula: C30H46O3
454.7
ACM6246464
Ursomic acid; ursonic acid; ursonic acd; 3-oxo-ursolic acid; 3-Ketone;
URUSHIOL
CAS:53237-59-5
0
ACM53237595
URUSHIOL;URUSHIOLS
UV-320
CAS:3846-71-7
Formula: C20H25N3O
323.44
ACM3846717
TINUVIN 320;ULTRAVIOLET ABSORBER UV-320;UV-320;2-BENZOTRIAZOLE-2-YL-4,6-DI-TERT-BUTYLPHENOL;2-(2-HYDROXY-3,5-DI-TERT-BUTYLPHENYL)BENZOTRIAZOLE;2-(2-HYDROXY-3,5-DI-TERT-BUTYLPHENYL)BENZOTRIAZOLE;2-(2H-BENZOTRIAZOL-2-YL)-4,6-DI-T-BUTYLPHENOL;2-(2H-benzotria
UV-400
CAS:153519-44-9
Formula: C81H108N6O8
1293.76
ACM153519449
TINUVIN 400;3-benzenediol,4-[4,6-bis(2,4-dimethylphenyl)-1,3,5-triazin-2-yl]-reaction;hyl]derivs.;productswith[(dodecyloxy)methyl]oxiraneandoxiranemono[(c10-16-alkyloxy)met;2-[4-[2-HYDROXY-3-TRIDECYL OXYPROPYL]OXY]-2-HYDROXYPHENYL]-4,6-BIS(2,4-DIMETHYLPH
UV-405
CAS:137658-79-8
Formula: C36H45N3O4
583.76
ACM137658798
UV1130
CAS:104810-47-1
Formula: C20H23N3O3
353.42
ACM104810471
UVI 3003
CAS:847239-17-2
Formula: C28H36O4
C28H36O4
ACM847239172
V TYPE AAO TEMPLATE(HOLE DEPTH :500 NM)
CAS:11092-32-3
ACM11092323-33
V TYPE AAO TEMPLATE(HOLE DEPTH:260 NM)
CAS:11092-32-3
ACM11092323-52
V TYPE AAO TEMPLATE(PORE DIAMETER: 450 NM)
CAS:11092-32-3
ACM11092323-57
V TYPE AAO TEMPLATE(PORE DIAMETER: 90-40 NM)
CAS:11092-32-3
ACM11092323-51
V5 PEPTIDE
CAS:922704-46-9
1524.78
ACM922704469
VABICASERIN
CAS:620948-93-8
Formula: C15H20N2
228.337
ACM620948938
VABICASERIN;(6aS,9aR)-rel-(-)-1,2,3,4,6,6a,7,8,9,9a-Decahydrocyclopenta[4,5]pyrido[3,2,1-jk][1,4]benzodiazepine
VACCENYL (CIS) METHANE SULFATE
Formula: C19H38O3S
346.57
ACM-00003933
VACCENYL (TRANS) METHANE SULFATE
Formula: C19H38O3S
346.57
ACM-00003930
VACUOLIN-1
CAS:351986-85-1
Formula: C26H24IN7O
577.42
ACM351986851
VAL-ALA P-NITROANILIDE ACETATE
CAS:108321-94-4
Formula: C14H20N4O4
308.33
ACM108321944
VAL-ALA p-NITROANILIDE, 108321-94-4
VAL-ALA-PRO-GLY ACETATE SALT
CAS:66835-73-2
Formula: C17H30N4O7
402.44
ACM66835732
VAL-ASP-(ARG8)-VASOPRESSIN
CAS:100930-18-5
Formula: C55H78N16O17S2
1298.45
ACM100930185
H-VAL-ASP-CYS-TYR-PHE-GLN-ASN-CYS-PRO-ARG-GLY-NH2;VAL-ASP-(ARG8)-VASOPRESSIN;H-Val-Asp-Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly-NH2 (Disulfide bond)
VAL-GLU-GLU-ALA-GLU
CAS:100930-17-4
Formula: C23H40N6O12
575.6
ACM100930174
VAL-GLU-GLU-ALA-GLU, 100930-17-4
VAL-GLU-PRO-ILE-PRO-TYR
CAS:94773-24-7
Formula: C35H52N6O10
716.82
ACM94773247
VAL-THR
CAS:72636-02-3
Formula: C9H18N2O4
218.25
ACM72636023
VALACICLOVIR
CAS:124832-26-4
Formula: C13H20N6O4
324.34
ACM124832264
L-VALINE 2-[(2-AMINO-1,6-DIHYDRO-6-OXO-9H-PURIN-9YL)METHOXY]ETHYL ESTER;L-VALINE 2-[(2-AMINO-1,6-DIHYDRO-6-OXO-9H-PURIN-9YL)METHOXY]ETHYL ESTER, HYDROCHLORIDE SALT;l-valine 2-(guanin-9-ylmethoxy)ethyl ester;VALACICLOVIR;VALACICLOVIR HCL;VALACICLOVIR HYDRO
VALACYCLOVIR HYDROCHLORIDE
CAS:124832-27-5
Formula: C13H21ClN6O4
360.8
ACM124832275
VALACICLOVIR HCL;VALACICLOVIR HYDROCHLORIDE;VALACV;VALACYCLOVIR;VALACYCLOVIR HYDROCHLORIDE;L-VALINE 2-[(2-AMINO-1,6-DIHYDRO-6-OXO-9H-PURIN-9YL)METHOXY]ETHYL ESTER, HYDROCHLORIDE SALT;VALACICLOVIR HCL 99%;VALACICLOVIR HYDROCHLORIDE,98.0+%
VALERALDEHYDE-O-PENTAFLUOROPHENYLMETHYL-OXIME
CAS:932710-56-0
Formula: C12H12F5NO
281.22
ACM932710560
Pentanal-O-pentafluorophenylmethyl-oxime, Valeraldehyde O-2,3,4,5,6-PFBHA-oxime, Valeraldehyde-O-pentafluorophenylmethyl-oxime, n-Pentanal oxime, o-[(pentafluorophenyl)methyl]-, 66156_FLUKA, 932710-56-0
VALERANILIDE
CAS:10264-18-3
Formula: C11H15NO
177.243 g/mol
ACM10264183
VALERIAN EXTRACTIVE
ACM-00003357
VALERIC ACID-1-13C
CAS:38765-82-1
Formula: C5H10O2
103.12
ACM38765821
Valeric acid-1-13C, Pentanoic acid-1-13C, 38765-82-1
VALEROPHENONE
CAS:1009-14-9
Formula: C11H14O
162.23
ACM1009149
VALEROPHENONE P-TOLUENESULFONYLHYDRAZONE
CAS:69015-74-3
Formula: C18H22N2O2S
330.44
ACM69015743
Valerophenone tosylhydrazone, 69015-74-3, AC1MXFAC, ACMC-20aja5, 4-methyl-N-(1-phenylpentylideneamino)benzenesulfonamide, CTK8C5332, MCULE-9457174840, 4-methyl-N-(1-phenylpentylidene)benzenesulfonohydrazide
VALETHAMATE BROMIDE
CAS:90-22-2
Formula: C19H32NO2?Br
386.37
ACM90222
VALGANCICLOVIR HYDROCHLORIDE
CAS:175865-59-5
Formula: C14H23ClN6O5
390.82
ACM175865595
VALGANCICLOVIR HYDROCHLORIDE;L-VALINE, 2-[(2-AMINO-1,6-DIHYDRO-6-OXO-9H-PURIN-9-YL)METHOXY]-3-HYDROXYPROPYL ESTER, MONOHYDROCHLORIDE;VALGANCICLOVIR HCL;L-VALINE,2-[(2-AMINO-1,6-DIHYDRO-6-OXO-9H-PURIN-9-YL)METHOXY]-3-HYDROXYPROPYLESTER,MONOHYDROCHLORIDE;Ro
VALIDOXYLAMINE A
CAS:82309-75-9
Formula: C14H25NO8
335.35
ACM82309759
VALIDOXYLAMINE A
VALIENAMINE
CAS:38231-86-6
Formula: C7H13NO4
175.18
ACM38231866
VALIENAMINE;(+)-VALIENAMINE, HYDROCHLORIDE;4-AMINO-2-(HYDROXYMETHYL)CYCLOHEX-2-ENE-1,5,6-TRIOL;6-AMINO-4-(HYDROXYMETHYL)-4-CYCLOPEXENE-1,2,3-TRIOL, HYDROCHLORIDE;(1S,2S,3R,6S)-6-Amino-4-(hydroxymethyl)-4-cyclohexene-1,2,3-triol;(1S,2S,3R,6S)-6-AMINO-4-(HY
VALINOL
CAS:16369-05-4
Formula: C5H13NO
103.16
ACM16369054
VALNEMULIN
CAS:101312-92-9
Formula: C31H54N2O5S
566.84
ACM101312929
VALNEMULIN;2-[[2-[[(2R)-2-Amino-3-methyl-1-oxobutyl]amino]-1,1-dimethylethyl]thio]acetic Acid (3aS,4R,5S,6S,8R,9R,9aR,10R)-6-Ethenyldecahydro-5-hydroxy-4,6,9,10- tetramethyl-1-oxo-3a,9-propano-3aH-cyclopentacycloocten-8-yl Ester
VALNEMULIN HYDROCHLORIDE
CAS:133868-46-9
Formula: C31H53ClN2O5S
601.28
ACM133868469
VALNEMULIN HYDROCHLORIDE;econor;VALNEMULIN HCL;Etodoiac;Acetic acid,[[2-[[(2R)-2-aMino-3-Methyl-1-oxobutyl]aMino]-1,1-diMethylethyl]thio]-,(3aS,4R,5S,6S,8R,9R,9aR,10R)-6-ethenyldecahydro-5-hydroxy-4,6,9,10-tetraMethyl-1-oxo-3a,9-propano-3aH-cyclopentacycl
VALNOCTAMIDE
CAS:4171-13-5
Formula: C8H17NO
143.23
ACM4171135
valnoctamide;2-Ethyl-3-methylpentan-amide;2-Ethyl-3-methylvaleramide;Axiquel;McN-X-181;Nirvani;Valmethamide;Nirvanil
VAN DYKE BROWN
CAS:72669-22-8
Formula: MFCD00148765
ACM72669228
VANADIUM BORIDE
CAS:12045-27-1
Formula: B2V
72.56
ACM12045271
Vanadium boride, Vanadium boride (VB), 12045-27-1
VANADIUM CARBIDE NANOPARTICLES
CAS:12070-10-9
Formula: VC
62.95
ACM12070109
HV 160;VANADIUM CARBIDE;VANADIUM CARBIDE, POWDER, 1.5 TO 2 MICRO N;VANADIUM CARBIDE, 99% (METALS BASIS);Vanadiumcarbide(metalsbasis);vanadium(iv) carbide;VANADIUM CARBIDE HV 160 - A PRODUCT OF H.C.STARCK;Vanadium monocarbide
VANADIUM CARBIDE NANOPARTICLES
CAS:12070-10-9
Formula: VC
62.95
ACM12070109
HV 160;VANADIUM CARBIDE;VANADIUM CARBIDE, POWDER, 1.5 TO 2 MICRO N;VANADIUM CARBIDE, 99% (METALS BASIS);Vanadiumcarbide(metalsbasis);vanadium(iv) carbide;VANADIUM CARBIDE HV 160 - A PRODUCT OF H.C.STARCK;Vanadium monocarbide
VANADIUM DISULFIDE
CAS:12166-28-8
0
ACM12166288
vanadium disulfide
VANADIUM FLUORIDE (VF4)(7CI,8CI,9CI)
CAS:10049-16-8
Formula: F4V
126.9351
ACM10049168
Vanadium pentafluoride, Vanadium tetrafluoride, EINECS 232-023-9, EINECS 233-171-7, 10049-16-8, 7783-72-4
VANADIUM NANOPARTICLES
CAS:7440-62-2
Formula: V
163.00
ACM7440622-7
Vanadium nanopowder
VANADIUM NANOPARTICLES
CAS:7440-62-2
Formula: V
163.00
ACM7440622-7
Vanadium nanopowder
VANADIUM NITRIDE NANOPARTICLES
CAS:24646-85-3
Formula: VN
64.95
ACM24646853
Nitridovanadium
VANADIUM NITRIDE NANOPARTICLES
CAS:24646-85-3
Formula: VN
64.95
ACM24646853
Nitridovanadium
VANADIUM OXIDE
CAS:12037-42-2
Formula: O13V6
513.64
ACM12037422
VANADIUM OXIDE
CAS:12035-98-2
Formula: OV
66.94
ACM12035982
Vanadium oxide (VO);vanadiumoxide(vo);VO;VANADIUM OXIDE;VANADIUM (II) OXIDE;VANADIUM (II) OXIDE 99.5%;Vanadium(II)oxide(metalsbasis);Vanadium(II) oxide, 99+% (metals basis)
VANADIUM OXYOXALATE
CAS:15500-04-6
Formula: C2O5V
154.96
ACM15500046
Oxalic acid oxovanadium(IV) salt
VANADIUM SINGLE CRYSTAL DISC, 10MM (0.39IN) DIA, 1-3MM (0.04-0.1IN) THICK, (100) ORIENTATION, 0.5
CAS:7440-62-2
ACM7440622-3
VANADIUM SINGLE CRYSTAL DISC, 10MM (0.39IN) DIA, 1-3MM (0.04-0.1IN) THICK, (110) ORIENTATION, 0.5
CAS:7440-62-2
Formula: V
163
ACM7440622-5
VANADIUM SINGLE CRYSTAL DISC, 10MM (0.39IN) DIA, 1-3MM (0.04-0.1IN) THICK, (111) ORIENTATION, 0.5
CAS:7440-62-2
Formula: V
163
ACM7440622
VANADIUM SINGLE CRYSTAL, 11-12MM (0.43-0.47IN) DIA, 100MM (3.9IN) LONG, (100) ORIENTATION, 2
CAS:7440-62-2
Formula: V
163
ACM7440622-2
VANADIUM SINGLE CRYSTAL, 11-12MM (0.43-0.47IN) DIA, 100MM (3.9IN) LONG, (110) ORIENTATION, 2
CAS:7440-62-2
ACM7440622-1
VANADIUM SINGLE CRYSTAL, 11-12MM (0.43-0.47IN) DIA, 100MM (3.9IN) LONG, (111) ORIENTATION, 2
CAS:7440-62-2
ACM7440622-4
VANADIUM SINGLE CRYSTAL, 11-12MM (0.43-0.47IN) DIA, 100MM (3.9IN) LONG, RANDOM ORIENTATION
CAS:7440-62-2
ACM7440622-6
VANADIUM TRIFLUORIDE
CAS:10049-12-4
Formula: F3V
107.03
ACM10049124
VF3;VANADIUM(III) FLUORIDE;VANADIUM TRIFLUORIDE;Vanadium(III) fluoride 98%;Vanadium(III)fluoride98%;VANADIUM (III) FLOURIDE;Vanadium(III) trifluoride
VANADIUM(II) CHLORIDE
CAS:10580-52-6
Formula: VCl2;Cl2V;
121.841g/mol
ACM10580526
EINECS 234-176-7; Vanadous chloride; Vanadium(II) chloride; AC1L2570; DTXSID60147349; VCl2; Vanadium(II) chloride, 85%;
VANADIUM(III) ACETYLACETONATE
CAS:13476-99-8
Formula: C15H24O6V;
351.293g/mol
ACM13476998
vanadium(IV) acetylacetonate; Vanadium, tris(2,4-pentanedionato-O,O')-, (OC-6-11)-; C15H21O6V; Vanadium(III) acetylacetonate, 97%; Vanadium, tris(2,4-pentanedionato-.kappa.O2,.kappa.O4)-, (OC-6-11)-; Vanadium, tris(2,4-pentanedionato)-; Vanadium, tris(2,4
VANADIUM(III) CHLORIDE
CAS:7718-98-1
ACM7718981
VANADIUM(III) CHLORIDE TETRAHYDROFURAN COMPLEX (1:3)
CAS:19559-06-9
Formula: C4H8Cl3OV;
229.398g/mol
ACM19559069
Trichlorotris(tetrahydrofuran)vanadium;19559-06-9;Vanadium(III) chloride-tetrahydrofuran complex (1:3), 0.5M solution in methylene chloride, AcroSeal(R);MFCD00145515;SCHEMBL7929736;Vanadium(III) chloride tetrahydrofuran adduct;Vanadium(III) chloride tetra
VANADIUM(III) IODIDE
CAS:15513-94-7
Formula: I3V
431.65
ACM15513947
VANADIUM(III)BROMIDE
CAS:13470-26-3
Formula: Br3V
290.65
ACM13470263
VANADIUM(III) BROMIDE;VANADIUM BROMIDE;vanadiumbromide(vbr3);vanadiumtribromide;Vanadiumbromidemeshblackpowder;VANADIUM (III) BROMIDE (99.7%-V);VANADIUM (III) BROMIDE, 99.5% (METALS BASIS);Vanadium(?)bromide
VANADIUM(III)BROMIDE
CAS:13470-26-3
Formula: Br3V
290.65
ACM13470263
VANADIUM(III) BROMIDE;VANADIUM BROMIDE;vanadiumbromide(vbr3);vanadiumtribromide;Vanadiumbromidemeshblackpowder;VANADIUM (III) BROMIDE (99.7%-V);VANADIUM (III) BROMIDE, 99.5% (METALS BASIS);Vanadium(?)bromide
VANADIUM(IV) OXIDE
CAS:12036-21-4
Formula: VO2;O2V;
82.939g/mol
ACM12036214
Vanadium(iv)oxide; Vanadium(IV) oxide; CTK8D9101; EC 234-841-1; EINECS 234-841-1; AC1L348E; 8921AF; 12036-21-4; Vanadium oxide (VO2); Vanadium dioxide;
VANADIUM(IV) OXIDE SULFATE
CAS:27774-13-6
Formula: VOSO4 or O5SV
163.01
ACM27774136
Vanadyl sulfate
VANADIUM(IV) OXIDE SULFATE HYDRATE
CAS:123334-20-3
Formula: VOSO4 xH2O
163.00 (anhydrous basis)
ACM123334203
OXYSULFATO VANADIUM (IV) HYDRATE;VANADYL(IV)-SULFATE HYDRATE;VANADYL SULFATE HYDRATE;VANADIUM(IV) OXIDE SULFATE HYDRATE;VANADIUM(IV) OXIDE SULFATE N-HYDRATE;VANADIUM (IV) OXYSULFATE, HYDROUS;VANADIUM (IV) SULFATE OXIDE HYDRATE;VANADYL SULFATE TRIHYDRATE,
VANADIUM(V) OXYFLUORIDE
CAS:13709-31-4
Formula: F3OV;F3H3OV;
126.96g/mol
ACM13709314
13709-31-4; Trifluorooxovanadium; SBB085542; J-006960; EINECS 237-250-7; Vanadium(V) oxyfluoride, 99%; trifluoro(oxo)vanadium; Vanadium oxytrifluoride;
VANADIUM(V) OXYTRIETHOXIDE
CAS:1686-22-2
Formula: C6H18O4V;
205.148g/mol
ACM1686222
Vanadium(v)oxytriethoxide; Triethyl vanadate; Vanadium(V) oxytriethoxide; IOHMVQGDVUCILM-UHFFFAOYSA-N; I14-58465; 1686-22-2; EINECS 216-870-1; Triethoxo-oxovanadium; ethylorthovanadate;
VANADIUM(V) OXYTRIPROPOXIDE
CAS:1686-23-3
Formula: C9H24O4V;
247.228g/mol
ACM1686233
EINECS 216-871-7; Vanadium(V) oxytripropoxide; Vanadyl-tris-n-propylester; Vanadium(V) tri-n-propoxide oxide; Vanadium(v)oxytripropoxide; 1686-23-3; Vanadium(V) tripropoxide oxide;
VANADYL 2 11 20 29-TETRA-TERT-BUTYL-2 3&
CAS:105011-00-5
Formula: C64H56N8OV
1004.14
ACM105011005
VANADYL 2 11 20 29-TETRA-TERT-BUTYL-2 3&;vanadyl 2,11,20,29-tetra-tert-butyl-2,3-naphthalo;Vanadyl 2,11,20,29-tetra-tert-butyl-2,3-naphthalocyanine Dye content 95 %
VANADYL 2 9 16 23-TETRAPHENOXY-29H 31H-&
CAS:109738-21-8
Formula: C56H32N8O5V
947.862
ACM109738218
VANADYL 2 9 16 23-TETRAPHENOXY-29H 31H-&;vanadyl 2,9,16,23-tetraphenoxy-29H,31H-phthalocya;VANADYL 2,9,16,23-TETRAPHENOXY-29H,*31H- PHTHALOCYAN;Vanadyl 2,9,16,23-tetraphenoxy-29H,31H-phthalocaynine;Vanadyl 2,9,16,23-tetraphenoxy-29H,31H-phthalocyanine Dye
VANADYL 2 9 16 23-TETRAPHENOXY-29H 31H-&
CAS:109738-21-8
Formula: C56H32N8O5V
947.862
ACM109738218
VANADYL 2 9 16 23-TETRAPHENOXY-29H 31H-&;vanadyl 2,9,16,23-tetraphenoxy-29H,31H-phthalocya;VANADYL 2,9,16,23-TETRAPHENOXY-29H,*31H- PHTHALOCYAN;Vanadyl 2,9,16,23-tetraphenoxy-29H,31H-phthalocaynine;Vanadyl 2,9,16,23-tetraphenoxy-29H,31H-phthalocyanine Dye
VANADYL 2,3-NAPHTHALOCYANIDE
CAS:33273-15-3
Formula: C48H24N8OV
779.7
ACM33273153
VANADYL 2,3-NAPHTHALOCYANIDE;vanadyl 2,3-naphthalocyanine
VANADYL 3,10,17,24-TETRA-TERT-BUTYL-1,8,15,22-TETRAKIS(DIMETHYLAMINO)-29H-PHTHALOCYANINE
CAS:61114-01-0
Formula: C56H68N12OV
976.16
ACM61114010
VANADYL 3,10,17,24-TETRA-TERT-BUTYL-1,8,15,22-TETRAKIS(DIMETHYLAMINO)-29H-PHTHALOCYANINE;Vanadyl 3,10,17,24-tetra-tert-butyl-1,8,15,22-tetrakis(dimethylamino)-29H,31H-phthalocyanine;vanadyl tetra-T-butyl-tetrakis(dimethyl-amino)-29;VANADYL TETRA-T-BUTYL-T
VANADYL 3,10,17,24-TETRA-TERT-BUTYL-1,8,15,22-TETRAKIS(DIMETHYLAMINO)-29H-PHTHALOCYANINE
CAS:61114-01-0
Formula: C56H68N12OV
976.16
ACM61114010
VANADYL 3,10,17,24-TETRA-TERT-BUTYL-1,8,15,22-TETRAKIS(DIMETHYLAMINO)-29H-PHTHALOCYANINE;Vanadyl 3,10,17,24-tetra-tert-butyl-1,8,15,22-tetrakis(dimethylamino)-29H,31H-phthalocyanine;vanadyl tetra-T-butyl-tetrakis(dimethyl-amino)-29;VANADYL TETRA-T-BUTYL-T
VANADYL ACETYLACETONATE BOUND TO POLYANILINE
ACM-00013778
VANADYL(II) ETHYL/BUTYL PHOSPHONATE SILICA (PHOSPHONICS POVO)
ACM-00013779
VANCOMYCIN HCL - PHARMA GRADE
CAS:1404-93-9
Formula: C66H75Cl2N9O24HCl
1485.71
ACM1404939-1
Vancomycin monohydrochloride
VANCOMYCIN HYDROCHLORIDE HYDRATE
CAS:123409-00-7
Formula: C66H75Cl2N9O24??HCl??xH2O
1485.71 (anhydrous b
ACM123409007
VANCOMYCIN?
CAS:1404-90-6
ACM1404906
VANILLIC ACID 4--D-GLUCOSIDE
CAS:32142-31-7
Formula: C14H18O9
330.29
ACM32142317
4-Hydroxy-3-methoxybenzoic acid 4-|A-D-glucoside; Vanillic acid 4-|A-D-glucopyranoside; Vanillic acid 4-|A-D-glucoside;
VANILLIC ACID HYDRAZIDE
CAS:100377-63-7
Formula: C8H10N2O3
182.18
ACM100377637
4-hydroxy-3-methoxybenzohydrazide, Vanillic Acid Hydrazide, 100377-63-7, AC1LAHM5, 4-???-2-methoxyphenol, ACMC-1C6ZY, AC1Q7AD5, SureCN2664428, Oprea1_419318, Oprea1_661676, CHEMBL125640, STOCK2S-34628, 4-Hydroxy-3-methoxybenzhydrazide, CTK3J2083, MolPort-
VANILLIN AZINE
CAS:1696-60-2
Formula: C16H16N2O4
300.31
ACM1696602
VAPREOTIDE
CAS:103222-11-1
Formula: C57H70N12O9S2
ACM103222111
VAPREOTIDE
CAS:103222-11-3
Formula: C57H70N12O9S2
1131.37
ACM103222113
RC-160;VAPREOTIDE;D-PHE-CYS-TYR-D-TRP-LYS-VAL-CYS-TRP-NH2;FCYWKVCW-NH2;D-Phe-L-Cys(1)-L-Tyr-D-Trp-L-Lys-L-Val-L-Cys(1)-L-Trp-NH2;Octastatin
VARENICLINE TARTRATE
CAS:375815-87-5
Formula: C17H19N3O6
361.34926
ACM375815875
VARENICLINE TARTRATE;Varenicline tartrate for research;7,8,9,10-Tetrahydro-6,10-methano-6H-pyrazino[2,3-h][3]benzazepine (2R,3R)-2,3- dihydroxybutanedioate;Champix;CP 526555-18;6,10-Methano-6H-pyrazino(2,3-H)(3)benzazepine, 7,8,9,10-tetrahydro-, (2R,3R)-2
VARIAMINE BLUE B
CAS:3566-44-7
Formula: C13H14N2OHCl
250.73
ACM3566447
Variamine Blue B Base, A0647_SIGMA, CID77108, EINECS 222-652-7, SBB003144, N-(p-Methoxyphenyl)-p-phenylenediamine, 4-AMINO-4-METHOXYDIPHENYLAMINE HCl, 4-Amino-4-methoxydiphenylamine hydrochloride, N-(4-Methoxyphenyl)benzene-1,4-diamine monohydrochloride,
VARIAMINE BLUE B
CAS:3566-44-7
Formula: C13H14N2OHCl
250.73
ACM3566447
Variamine Blue B Base, A0647_SIGMA, CID77108, EINECS 222-652-7, SBB003144, N-(p-Methoxyphenyl)-p-phenylenediamine, 4-AMINO-4-METHOXYDIPHENYLAMINE HCl, 4-Amino-4-methoxydiphenylamine hydrochloride, N-(4-Methoxyphenyl)benzene-1,4-diamine monohydrochloride,
VASELINE
CAS:8009-3-8
ACM800938
VASOACTIVE INTESTINALOCTACOSAPEPTIDE(SWINE),6-(4-CHLORO-D-PHENYLALANINE)-17-L-LEUCINE-(9CI)
CAS:102805-45-8
Formula: C148H239ClN44O42
3342.2
ACM102805458
VAT BLACK 16
CAS:1328-19-4
Formula: C34H18N2O2
486.52
ACM1328194
vat black 16;Vat Grey 3 B Powder;C.I. Vat black 16;Vat black 16 (C.I. 59855);Grey 3B;Dycosthren Grey 3B;Navinon Black SNA;Navinon Grey 3B
VAT BLACK 22
CAS:61868-00-6
ACM61868006
Vat Black 22
VAT BLACK 25
CAS:4395-53-3
Formula: C45H22N2O5
670.67
ACM4395533
Vat Olivet;3-(anthraquinon-1-ylamino)anthra[2,1,9-mna]naphth[2,3-h]acridine-5,10,15(16H)-trione;Vat Olive (Original Powder);Anthra2,1,9-mnanaphth2,3-hacridine-5,10,15(16H)-trione, 3-(9,10-dihydro-9,10-dioxo-1-anthracenyl)amino-;C.I.VATBLACK25;Vat black 2
VAT BLACK 27
CAS:2379-81-9
Formula: C42H23N3O6
665.66
ACM2379819
N,N'-(10,15,16,17-tetrahydro-5,10,15,17-tetraoxo-5H-dinaphtho[2,3-a:2',3'-i]carbazole-6,9-diyl)bis(benzamide);Vat Olive Green R;Benzamide, N,N-(10,15,16,17-tetrahydro-5,10,15,17-tetraoxo-5H-dinaphtho2,3-a:2,3-icarbazole-6,9-diyl)bis-;C.I.VATBLACK27;Vat b
VAT BLACK 29
CAS:6049-19-0
Formula: C64H34N4O8
986.98
ACM6049190
Vat Black 29;N,N'-[(6,12-dihydro-6,12-dioxodibenzo[def,mno]chrysene-4,10-diyl)bis[imino(9,10-dihydro-9,10-dioxoanthracene-4,1-diyl)]bis(benzamide)];C.I. Vat Balck 29;Vat black 29 (C.I. 65225);Benzamide, N,N'-[(6,12-dihydro-6,12- dioxodibenzo[def,mno]chr
VAT BLACK 29
CAS:6049-19-0
Formula: C64H34N4O8
986.98
ACM6049190
Vat Black 29;N,N'-[(6,12-dihydro-6,12-dioxodibenzo[def,mno]chrysene-4,10-diyl)bis[imino(9,10-dihydro-9,10-dioxoanthracene-4,1-diyl)]bis(benzamide)];C.I. Vat Balck 29;Vat black 29 (C.I. 65225);Benzamide, N,N'-[(6,12-dihydro-6,12- dioxodibenzo[def,mno]chr
VAT BLACK 38
CAS:12237-35-3
ACM12237353
Vat Black 38;Black DB;Indanthrene Direct Black APB
VAT BLACK 8
CAS:2278-50-4
Formula: C45H19N3O4
665.65
ACM2278504
1H-benz[6,7]indazole[2,3,4-fgh]naphth[2'',3'':6',7']indolo[3',2':5,6]anthra[2,1,9-mna]acridine-2,7,10,15-tetrone;Vat black 8 (C.I. 71000);1H-Benz[6,7]indazolo[2,3, 4-fgh]naphth[2'',3'':6',7']indolo[3',2':5,6]anthra [2,1,9-mna]acridine-2,7,10,15-tetrone;D
VAT BLACK 9
CAS:1328-25-2
Formula: C126H58O10N4
ACM1328252
Vat Black 9;Anthra[9,1,2-cde]benzo[rst]pentaphene-5,10-dione, amino-, reaction products with 1-amino-9,10-anthracenedione and tetrabromo-8,16-pyranthrenedione;C.I. Vat Black 9;Vat black 9 (C.I. 65230);Dycosthren Black RB;Indonon Direct Black RB;Mikethr
VAT BLACK 9
CAS:1328-25-2
Formula: C126H58O10N4
ACM1328252
Vat Black 9;Anthra[9,1,2-cde]benzo[rst]pentaphene-5,10-dione, amino-, reaction products with 1-amino-9,10-anthracenedione and tetrabromo-8,16-pyranthrenedione;C.I. Vat Black 9;Vat black 9 (C.I. 65230);Dycosthren Black RB;Indonon Direct Black RB;Mikethr
VAT BLUE 1,REDUCED
CAS:894-86-0
Formula: C16H10N2Na2O2
308.24234
ACM894860
Vat Blue 1, Reduced;disodium [2,2-bi-1H-indole]-3,3-diolate;Reduced Vat Blue1;[2,2-bi-1H-Indole]-3,3-diol, disodium salt;3,3-Bis(sodiooxy)-2,2-bi(1H-indole);3,3-Bis(sodiooxy)-2,2-bi[1H-indole];C.I.Reduced Vat Blue 1;disodium 2-(3-oxidanidyl-1H-indol-2-yl)
VAT BLUE 14
CAS:1324-27-2
Formula: C28H13ClN2O4
476.87
ACM1324272
Vat Blue 14;chloro-6,15-dihydroanthrazine-5,9,14,18-tetrone;chloro-6,15-dihydro-5,9,14,18-Anthrazinetetrone;Vat blue 14 (C.I. 69810);5, 9, 14, 18-Anthrazinetetrone, chloro-6, 15-dihydro;Dycosthren Blue GCDN;Hebeithrene Blue GCDN;Kenanthrene Blue GCD
VAT BLUE 19
CAS:1328-18-3
Formula: C34H16O2
456.49
ACM1328183
Vat Blue 19;Anthra[9,1,2-cde]benzo[rst]pentaphene-5,10-dione, bromo derivs.;C.I.VATBLUE19;Vat blue 19 (C.I. 59805);Navy Blue BF;C.I.59805;Indanthrene Navy Blue BF;Palanthrene Navy Blue BF
VAT BLUE 4
CAS:81-77-6
Formula: C28H14N2O4
442.43
ACM81776
VAT BLUE 4
CAS:81-77-6
Formula: C28H14N2O4
442.43
ACM81776
VAT BLUE 42
CAS:1327-81-7
Formula: C20H18N2O
302.37
ACM1327817
Vat Blue 42;Phenol, 4-[(9-ethyl-9H-carbazol-3-yl)amino]-, reaction products with sodium sulfide (Na2(Sx));Sulfur Vat Blue GNX;Vat blue 42 (C.I. 53640);C.I. Vat Blue 42;Blue GNX;Dycosulfux Vat Blue GNX.;C.I.53640
VAT BLUE 43
CAS:1327-79-3
ACM1327793
VAT BLUE 4B
CAS:2475-31-2
Formula: C16H6Br4N2O2
577.85
ACM2475312
Mitsui Tsuya Indigo 2B
VAT BLUE 6
CAS:130-20-1
Formula: C28H12Cl2N2O4
511.31188
ACM130201
3,3-Dichloroindanthrene;3,3-Dichloroindanthrone;5,9,14,18-Anthrazinetetrone, 7,16-dichloro-6,15-dihydro-;7,16-Dichloroindanthrone;7:16-Dichloro-6:15-indanthrone;Ahcovat Blue BCF;Alizanthrene Blue RC;Amanthrene Blue BCL
VAT BLUE 6, SOLUBILIZED
CAS:2519-28-0
Formula: C28H16Cl2N2O16S4.4Na
ACM2519280
tetrasodium 7,16-dichloro-6,15-dihydroanthrazine-5,9,14,18-tetrayl tetrakis(sulphate);Solubilised Vat Blue 6;6,15-Dihydro-7,16-dichloro-5,9,14,18-tetrakis(sodiosulfooxy)anthrazine;7,16-Dichloro-6,15-dihydro-5,9,14,18-anthrazinetetrol tetra(sulfuric acid
VAT BLUE 64
CAS:15935-52-1
Formula: C44H26N6O7
750.7244
ACM15935521
Vat Blue 64;N,N'-[1,3,4-oxadiazole-2,5-diylbis(4-amino-9,10-dihydro-9,10-dioxoanthracene-3,1-diyl)]bis(benzamide);Benzamide, N,N'-[1,3,4-oxadiazole-2, 5-diylbis(4-amino-9,10-dihydro-9,10-dioxo-3,1-anthracenediyl )]bis-;N,N'-[1,3,4-Oxadiazole-2,5-diylbis(
VAT BROWN 1
CAS:2475-33-4
Formula: C42H18N2O6
646.6
ACM2475334
VAT BROWN 1;16,23-dihydronaphth[2',3':6,7]indolo[2,3-c]dinaphtho[2,3-a:2'3'-i]carbazole-5,10,15,17,22,24-hexone;Vat Brown BR Powder;Naphth2,3:6,7indolo2,3-cdinaphtho2,3-a:2,3-icarbazole-5,10,15,17,22,24-hexone, 16,23-dihydro-;C.I.VATBROWN1;Vat brown 1 (C
VAT BROWN 14
CAS:8005-79-6
ACM8005796
Vat Brown 14;C.I.VATBROWN14;Brown B
VAT BROWN 22
CAS:8005-30-9
Formula: C26H10Cl2N4O2
ACM8005309
Vat Brown 22;Bisbenzimidazobenzo[lmn][3,8]phenanthrolinedione, dichloro-;C.I. Vat Brown 22
VAT BROWN 23
CAS:1328-26-3
ACM1328263
Vat Brown 23
VAT BROWN 25
CAS:6247-46-7
Formula: C43H25N3O7
695.685
ACM6247467
Vat Brown 25;N,N'-(10,15,16,17-tetrahydro-1-methoxy-5,10,15,17-tetraoxo-5H-dinaphtho[2,3-a:2',3'-i]carbazole-4,9-diyl)bis(benzamide);Benzamide, N,N-(10,15,16,17-tetrahydro-1-methoxy-5,10,15,17-tetraoxo-5H-dinaphtho2,3-a:2,3-icarbazole-4,9-diyl)bis-;Vat b
VAT BROWN 3
CAS:131-92-0
Formula: C42H23N3O6
665.65
ACM131920
C.I. VAT BROWN 3;Vatbrown;Benzamide, N,N-(10,15,16,17-tetrahydro-5,10,15,17-tetraoxo-5H-dinaphtho2,3-a:2,3-icarbazole-4,9-diyl)bis-;Calcoloid Brown R.;Vat brown 3 (C.I. 69015);C.I. 69015;C.I. Pigment Brown 28;N,N'-(10,15,16,17-Tetrahydro-5,10,15,17-tetra
VAT BROWN 5
CAS:3989-75-1
Formula: C24H12O2S2
396.489
ACM3989751
2-(1-oxonaphtho[2,1-b]thien-2(1H)-ylidene)naphtho[2,1-b]thiophen-1(2H)-one;Vat brown 5 (C.I. 73410);C.I.73410;C.I.Pigment Brown 27;C.I.Vat Brown 5;Calcotone Brown 2R;Lithosol Fast Brown GP;?2,2'(1H,1'H)-Binaphtho[2,1-b]thiophene-1,1'-dione
VAT BROWN 57
CAS:12227-28-0
ACM12227280
vat brown 57;Vat Dark Brown H2R
VAT BROWN 68
CAS:12237-38-6
ACM12237386
Vat Brown 68;Dycosthren Brown G;Mikethrene Brown G;Nihonthrene Brown G
VAT BROWN 72
CAS:12237-41-1
ACM12237411
Vat Brown 72;Brown GG;Dycosthren Brown GG;Mikethrene Brown GG;Nihonthrene Brown GG
VAT GREEN 1
CAS:128-58-5
Formula: C36H20O4
516.54
ACM128585
C.I. VAT GREEN 1;VAT Green 1;VAT Jade Green
VAT GREEN 11
CAS:1328-41-2
ACM1328412
Vat Green 11
VAT GREEN 13
CAS:57456-28-7
Formula: C46H21IN2O5
ACM57456287
vat green 13;Olive MW;C.I.Vat Green 13;Vat Green MW;Indanthren Olive MW;Indanthren Olive T-MW
VAT GREEN 2
CAS:25704-81-8
Formula: C36H18Br2O4
674.3422
ACM25704818
dibromo-16,17-dimethoxyanthra[9,1,2-cde]benzo[rst]pentaphene-5,10-dione;Anthra9,1,2-cdebenzorstpentaphene-5,10-dione, dibromo-16,17-dimethoxy-;Vat green 2 (C.I. 59830);Green 2G;C.I.59830;C.I.Vat Green 2;Dibromo-16,17-dimethoxyviolanthrone;Indanthren Bri
VAT GREEN 3
CAS:3271-76-9
Formula: C31H15NO3
449.46
ACM3271769
anthra[2,1,9-mna]naphth[2,3-h]acridine-5,10,15(16H)-trione;Vat Olive Green B;C.I.VATGREEN3;Vat green 3 (C.I. 69500;Olive Green B;Anthramar Olive Green B;Cibanone Olive B-01;Fabrivat Olive Green B
VAT GREEN 8
CAS:14999-97-4
Formula: C70H28N4O10
1085.01
ACM14999974
Vat Green 8;6,8,25,27-tetrahydrobisnaphtho[2',3':6,7]indolo[2,3-c:2',3'-c']dinaphtho[2,3-i:2',3'-i']benzo[1,2-a:5,4-a']dicarbazole-5,7,9,14,19,24,26,28,33,38-decaone;Vat Khaki 2G;C.I.VATGREEN8;Vat green 8 (C.I. 71050);Khaki 2G;Bisnaphth[2', 3' : 6, 7]
VAT GREEN 8
CAS:14999-97-4
Formula: C70H28N4O10
1085.01
ACM14999974
Vat Green 8;6,8,25,27-tetrahydrobisnaphtho[2',3':6,7]indolo[2,3-c:2',3'-c']dinaphtho[2,3-i:2',3'-i']benzo[1,2-a:5,4-a']dicarbazole-5,7,9,14,19,24,26,28,33,38-decaone;Vat Khaki 2G;C.I.VATGREEN8;Vat green 8 (C.I. 71050);Khaki 2G;Bisnaphth[2', 3' : 6, 7]
VAT ORANGE 1
CAS:1324-11-4
Formula: C24H10Br2O2
490.143
ACM1324114
c.i. 59105;C.I. Pigment Orange 77;c.i. vat orange 23;Bibromodibenzo[b,def]chrysene-7,14-dione;Vat Orange 1;dibromodibenzo[b,def]chrysene-7,14-dione;CIVATORANGE1;CIBANONEGOLDENYELLOWRK
VAT ORANGE 1,SOLUBILIZED
CAS:1324-15-8
Formula: C24H12Br2O8S2.2Na
0
ACM1324158
disodium dibromodibenzo[b,def]chrysene-7,14-diyl bis(sulphate);Solubilised Vat Orange 1;Vat orange 1 solubilized (C.I. 59106);Dibenzo[b,def]chrysene-7,14-diol, dibromo-, bis(hydrogen sulfate), disodium salt
VAT ORANGE 1,SOLUBILIZED
CAS:1324-15-8
Formula: C24H12Br2O8S2.2Na
0
ACM1324158
disodium dibromodibenzo[b,def]chrysene-7,14-diyl bis(sulphate);Solubilised Vat Orange 1;Vat orange 1 solubilized (C.I. 59106);Dibenzo[b,def]chrysene-7,14-diol, dibromo-, bis(hydrogen sulfate), disodium salt
VAT ORANGE 11
CAS:2172-33-0
Formula: C42H18N2O6
646.61
ACM2172330
6,18-dihydrodinaphtho[2,3-i:2',3'-i']benzo[1,2-a:4,5-a']dicarbazole-5,7,12,17,19,24-hexone;C.I. 70805;vat orange 11;Vat Yellow 3RT;Dinaphtho2,3-i:2,3-ibenzo1,2-a:4,5-adicarbazole-5,7,12,17,19,24(6H,18H)-hexone;C.I.VATORANGE11;Vat orange 11 (C.I. 70805);Y
VAT ORANGE 15
CAS:2379-78-4
Formula: C42H23N3O6
665.65
ACM2379784
N,N'-(10,15,16,17-Tetrahydro-5,10,15,17-tetraoxo-5H-dinaphtho[2,3-a:2',3'-i]carbazole-4,11-diyl)bis(benzamide);VAT ORANGE 15;c.i. 69025;C.I. Vat Orange 15;N,N-(10,15,16,17-tetrahydro-5,10,15,17-tetraoxo-5H-dinaphtho[2,3-a:2,3-i]carbazole)-4,11-di(benzami
VAT ORANGE 16
CAS:10142-57-1
Formula: C29H13NO5
ACM10142571
Vat Orange 16;C.I.Vat Orange 16;Dinaphth[2, 3-a: 2', 3'-h]acridine-5, 9, 14, 15, 18(6H)-pentone;Indanthren Orange F3R.;Vat Orange G;C.I.69540;Dinaphth[2,3-a:2',3'-h]acridine-5,9,14,15,18(6H)-pentone
VAT ORANGE 2
CAS:1324-35-2
Formula: C30H12Br2O2
564.23
ACM1324352
C.I. 59705;dibromopyranthrene-8,16-dione;VAT ORANGE 2;Vat Golden Orange 2RT;8,16-Pyranthrenedione, dibromo-;C.I.VATORANGE2;dibromo-16-pyranthrenedione;dibromo-8,16-pyranthrenedione
VAT ORANGE 3
CAS:4378-61-4
Formula: C22H8Br2O2
464.12
ACM4378614
4,10-Dibrom-dibenzo[def,mno]chrysen-6,12-dion; Indazin Scarlet GL; Lionogen Red GD; Helanthrene Orange RK; Hostaperm Scarlet GO; 4,10-dibromoanthanthrone; Monolite Red 2Y; Indanthrenbrillantorange RK; Lake Fast Red G; 4,10-dibromo-dibenzo[def,MnO]chrysene
VAT ORANGE 3
CAS:4378-61-4
Formula: C22H8Br2O2
464.12
ACM4378614
4,10-Dibrom-dibenzo[def,mno]chrysen-6,12-dion; Indazin Scarlet GL; Lionogen Red GD; Helanthrene Orange RK; Hostaperm Scarlet GO; 4,10-dibromoanthanthrone; Monolite Red 2Y; Indanthrenbrillantorange RK; Lake Fast Red G; 4,10-dibromo-dibenzo[def,MnO]chrysene
VAT ORANGE 4
CAS:1324-33-0
Formula: C30H11Br3O2
643.11914
ACM1324330
Vat Orange 4;tribromopyranthrene-8,16-dione;8,16-Pyranthrenedione, tribromo-;C.I.59710;C.I.Vat Orange 4;Indanthren Orange 4R;Tribromo-8,16-pyrenthrenedione;1,2,3-tribromopyranthrene-8,16-dione
VAT ORANGE 7
CAS:4424-06-0
ACM4424060
VAT ORANGE 9
CAS:128-70-1
Formula: C30H14O2
406.44
ACM128701
8,16-Pyranthrenedione;C.I. VAT ORANGE 9;VAT Orange 9
VAT RED 10
CAS:2379-79-5
ACM2379795
VAT RED 14
CAS:8005-56-9
Formula: C26H12N4O2
412.4
ACM8005569
vat red 14;C.I. 71110;bisbenzimidazobenzo[lmn][3,8]phenanthrolinedione;Vat Red GG;Vat Scarlet GG;C.I.VATRED14;Vat red 14 (C.I. 71110);Scarlet GG
VAT RED 15
CAS:4216-02-8
Formula: C26H12N4O2
412.4
ACM4216028
c.i. 71100;C.I. Pigment Red 194;Bisbenzimidazo[2,1-b:1',2'-j]benzo[lmn][3,8]phenanthroline-6,9-dione;vat red 15;Vat Bordeaux HRR;PERMANENTREDTG01;C.I.VATRED15;BisBenzmidazo(2,1-b:1',2'-i)benzo(1MN)(3,8)phenanthroline-6,9-dione
VAT RED 31
CAS:12227-47-3
Formula: C30H16N4O5
512.47
ACM12227473
Vat Red F3B;C.I. VAT RED 31);2,2'-(1,3,4-Oxadiazole-2,5-diyl)bis(1-aminoanthracene-9,10-dione);Vat Red 31
VAT RED 32
CAS:2379-77-3
Formula: C36H16Cl2N2O4
611.43
ACM2379773
1,9-def:6,5,10-d'e'f']diisoquinoline-1,3,8,10(2H,9H)-tetrone,2,9-bis(4-chlorophenyl)-Anthra[2;anthra[2,1,9-def:6,5,10-d'e'f']diisoquinoline-1,3,8,10(2h,9h)-tetrone,2,9-bis(;C.I. Pigment Red 189;c.i. 71135;2,9-Bis(4-chlorophenyl)-anthra[2,1,9-def:6,5,10-d
VAT RED 32
CAS:2379-77-3
Formula: C36H16Cl2N2O4
611.43
ACM2379773
1,9-def:6,5,10-d'e'f']diisoquinoline-1,3,8,10(2H,9H)-tetrone,2,9-bis(4-chlorophenyl)-Anthra[2;anthra[2,1,9-def:6,5,10-d'e'f']diisoquinoline-1,3,8,10(2h,9h)-tetrone,2,9-bis(;C.I. Pigment Red 189;c.i. 71135;2,9-Bis(4-chlorophenyl)-anthra[2,1,9-def:6,5,10-d
VAT RED 41
CAS:522-75-8
Formula: C16H8O2S2
296.36
ACM522758
VAT RED 42
CAS:2987-68-0
Formula: C28H18N2O4
446.46
ACM2987680
Vat Red 42;N,N'-(9,10-dihydro-9,10-dioxoanthracene-1,4-diyl)bisbenzamide;Vat red 42 (C.I. 61650);Algol Red 5G;C.I.61650;C.I.Vat Red 42;N-[4-(benzoylamino)-9,10-diketo-1-anthryl]benzamide;N-[4-(benzoylamino)-9,10-dioxoanthracen-1-yl]benzamide
VAT VIOLET 1
CAS:1324-55-6
Formula: C34H14Cl2O2
525.37976
ACM1324556
dichlorobenzo[rst]phenanthro[10,1,2-cde]pentaphene-9,18-dione;vat viloet 1;Benzorstphenanthro10,1,2-cdepentaphene-9,18-dione, dichloro-;C.I.VATVIOLET1;VAT1(VAT VIOLET 1);Vat violet 1 (C.I. 60010);Anthramar Brilliant Violet 2R;Cibanone Violet 2R
VAT VIOLET 10
CAS:128-64-3
Formula: C34H16O2
456.49
ACM128643
VAT VIOLET 13
CAS:4424-87-7
Formula: C28H14N2O4
442.42
ACM4424877
c.i. 68700;Benzo[1,2-c:4,5-c']diacridine-6,9,15,18(5H,14H)-tetrone;Vat Violet 13;C.I.VATVIOLET13;Vat violet 13 (C.I. 68700);Nihonthrene Violet BN
VAT VOILET 3
CAS:2379-75-1
Formula: C20H14Cl2O2S2
421.36
ACM2379751
Vat Voilet 3;5-chloro-2-(5-chloro-4,7-dimethyl-3-oxobenzo[b]thien-2(3h)-ylidene)-4,7-dimethylbenzo[b]thiophene-3(2h)-one;c.i. pigment violet 38;C.I. 73395;5,5-dichloro-4,4,7,7-tetramethyl-[2,2-bibenzo[b]thiophene]-3,3-dione;C.I. Vat Violet 3;Pigment Viol
VAT YELLOW 10
CAS:2379-76-2
Formula: C68H42N6O8
1071.11
ACM2379762
Vat Yellow 10;4',4'''-Azobis[N-[5-(benzoylamino)-9,10-dihydro-9,10-dioxo-1-anthryl][1,1'-biphenyl-4-carboxamide];c.i. 65430;4',4'''-Azobis[N-[5-(benzoylamino)-9,10-dihydro-9,10-dioxoanthracen-1-yl]-1,1'-biphenyl-4-carboxamide];C.I.Vat Yellow 10;Fenanthre
VAT YELLOW 10
CAS:2379-76-2
Formula: C68H42N6O8
1071.11
ACM2379762
Vat Yellow 10;4',4'''-Azobis[N-[5-(benzoylamino)-9,10-dihydro-9,10-dioxo-1-anthryl][1,1'-biphenyl-4-carboxamide];c.i. 65430;4',4'''-Azobis[N-[5-(benzoylamino)-9,10-dihydro-9,10-dioxoanthracen-1-yl]-1,1'-biphenyl-4-carboxamide];C.I.Vat Yellow 10;Fenanthre
VAT YELLOW 12
CAS:6370-75-8
Formula: C44H26N4O8
738.69924
ACM6370758
C.I. Vat Yellow 12;N,N-bis(5-benzamido-9,10-dihydro-9,10-dioxo-1-anthryl)oxalamide;Vat Yellow 12 (C.I.);N,N'-bis[5-(benzoylamino)-9,10-dihydro-9,10-dioxo-1-anthryl]oxamide;Vat Yellow 12;Vat yellow 12 (C.I. 65405);Ethanediamide, N,N'-bis[5-(benzoylamino)
VAT YELLOW 12
CAS:6370-75-8
Formula: C44H26N4O8
738.69924
ACM6370758
C.I. Vat Yellow 12;N,N-bis(5-benzamido-9,10-dihydro-9,10-dioxo-1-anthryl)oxalamide;Vat Yellow 12 (C.I.);N,N'-bis[5-(benzoylamino)-9,10-dihydro-9,10-dioxo-1-anthryl]oxamide;Vat Yellow 12;Vat yellow 12 (C.I. 65405);Ethanediamide, N,N'-bis[5-(benzoylamino)
VAT YELLOW 2
CAS:129-09-9
Formula: C28H14N2O2S2
474.55
ACM129099
VAT YELLOW 2;INDANTHRENE YELLOW GCN;1-d:6,5-d')bisthiazole-6,12-dione,2,8-diphenyl-anthra(;1-d:6,5-d']bisthiazole-6,12-dione,2,8-diphenyl-anthra[;ahcovatflavonegc;ahcovatflavonegcn;ahcovatprintingflavonegc;algolyellow2blt
VAT YELLOW 2
CAS:129-09-9
Formula: C28H14N2O2S2
474.55
ACM129099
VAT YELLOW 2;INDANTHRENE YELLOW GCN;1-d:6,5-d')bisthiazole-6,12-dione,2,8-diphenyl-anthra(;1-d:6,5-d']bisthiazole-6,12-dione,2,8-diphenyl-anthra[;ahcovatflavonegc;ahcovatflavonegcn;ahcovatprintingflavonegc;algolyellow2blt
VAT YELLOW 33
CAS:12227-50-8
Formula: C54H32N4O6
832.86
ACM12227508
4',4'''-azobis[n-(9,10-dihydro-9,10-dioxo-1-anthryl)]-[1,1'-biphenyl]-4-carboxamide;C.I. 65429;vat yellow 33;Vat yellow 33 (C.I. 65429);[1,1'-Biphenyl]-4-carboxamide, 4',4'''-azobis[N-(9,10-dihydro- 9,10-dioxo-1-anthracenyl)-;Yellow F3GC;Cibanone Yellow
VAT YELLOW 33
CAS:12227-50-8
Formula: C54H32N4O6
832.86
ACM12227508
4',4'''-azobis[n-(9,10-dihydro-9,10-dioxo-1-anthryl)]-[1,1'-biphenyl]-4-carboxamide;C.I. 65429;vat yellow 33;Vat yellow 33 (C.I. 65429);[1,1'-Biphenyl]-4-carboxamide, 4',4'''-azobis[N-(9,10-dihydro- 9,10-dioxo-1-anthracenyl)-;Yellow F3GC;Cibanone Yellow
VAT YELLOW 4
CAS:128-66-5
Formula: C24H12O2
332.35088
ACM128665
dibenzo[b,def]chrysene-7,14-dione;1,2,6,7-Dibenzpyrene-7,14-quinone;DIBENZO(B)CHRYSENE-7,14-DIONE;C.I.VATYELLOW4;Vat yellow 4 (C.I. 59100);C.I.59100;Indanthren Printing Yellow GOK;Nihonthrene Golden Yellow GK
VAT YELLOW 46
CAS:12237-50-2
ACM12237502
Vat Yellow 46;C.I. Vat Yellow 46
VB-FNPD
CAS:1173170-48-3
ACM1173170483
VBRIDP
CAS:384842-25-5
Formula: C23H31P;
338.475g/mol
ACM384842255-1
1,1-Diphenyl-2-(di-tert-butylphosphino)propene; DTXSID00475779; Di-tert-butyl(1-methyl-2,2-diphenylethenyl)phosphine; MFCD16621412; SCHEMBL377450; CYGZMOQFIMJEIT-UHFFFAOYSA-N; vBRIDP, 97%;
VCH-759
CAS:1001913-13-8
Formula: C25H30NNaO4S
463.564769 [g/mol]
ACM1001913138
VCH-759, CHEMBL1673159, 1001913-13-8, sodium 3-(N-((1r,4r)-4-hydroxycyclohexyl)-4-methylcyclohexane-1-carboxamido)-5-phenylthiophene-2-carboxylate
VECTOMER 2010 VINYL ETHER
CAS:143477-68-3
ACM143477683
VECTOMER 2020 VINYL ETHER
CAS:143477-70-7
ACM143477707
VELNEPERIT
CAS:342577-38-2
Formula: C17H24F3N3O3S
407.45
ACM342577382
velneperit;N-[5-(Trifluoromethyl)-2-pyridinyl]-trans-4-[[(1,1-dimethylethyl)sulfonyl]amino]cyclohexane-1-carboxamide
VENLAFAXINE HYDROCHLORIDE
CAS:99300-78-4
Formula: C17H28ClNO2
313.86
ACM99300784-1
EFFEXOR;D,L-VENLAFAXINE;D,L-VENLAFAXINE, HYDROCHLORIDE;1-[2-(DIMETHYLAMINO)-1-(4-METHOXYPHENYL)ETHYL]CYCLOHEXANOL, HCL;1-[2-(DIMETHYLAMINO)-1-(4-METHOXYPHENYL)ETHYL]CYCLOHEXANOL HYDROCHLORIDE;1-[2-(DIMETHYLAMINO)-1-(4-METHOXYPHENYL)ETHYL]CYCLOHEXANOL;(+/-
VERAPAMIL RELATED COMPOUND B(50 MG)(AL-PHA-[2-[[2-(3,4-DIMETHOXYPHENYL)-ETHYL]METHYLA-MINO]ETHYL]-3,4-DIMETHOXY-ALPHA-(1-METHY-LETHYL)-BENZENEACETONITRILE MONOHYDROCHLORIDE)
CAS:1794-55-4
Formula: C26H37ClN2O4
477.03598
ACM1794554
VERAPAMIL RELATED COMPOUND B (50 MG) (AL-PHA-[2-[[2-(3,4-DIMETHOXYPHENYL)-ETHYL]METHYLA-MINO]ETHYL]-3,4-DIMETHOXY-ALPHA-(1-METHY-LETHYL)-BENZENEACETONITRILE MONOHYDROCHLORIDE);Verapamil Related Compound B (50 mg) (alpha-[2-[[2-(3,4-dimethoxyphenyl)-ethyl]
VERAPAMIL-D7 HYDROCHLORIDE
CAS:1188265-55-5
Formula: C27H32ClD7N2O4
498.105692446
ACM1188265555
VerapaMil-d7 Hydrochloride
VERBASCOSIDE
CAS:22323-52-0
Formula: C29H36O15
624.59
ACM22323520
VERBASCOSIDE
CAS:61276-17-3
Formula: C29H36O15
624.59
ACM61276173
VERBASCOSIDE;ISOVERBASCOSIDE;KUSAGININ;B-D-GLUCOPYRANOSIDE, 2-(3,4-DIHYDROXYPHENYL)ETHYL 3-O-(6-DEOXY-ALPHA-L-MANNOPYRANOSYL)-,4-[3-(3,4-DIHYDROXYPHENYL)-2-PROPENOATE],(E)-;ACTEOSIDE;4-(3-(3,4-dihydroxyphenyl)-2-propenoate),(e)-beta-d-yl);glucopyranoside,
VERBASCOSIDE
CAS:61276-17-3
Formula: C29H36O15
624.59
ACM61276173
VERBASCOSIDE;ISOVERBASCOSIDE;KUSAGININ;B-D-GLUCOPYRANOSIDE, 2-(3,4-DIHYDROXYPHENYL)ETHYL 3-O-(6-DEOXY-ALPHA-L-MANNOPYRANOSYL)-,4-[3-(3,4-DIHYDROXYPHENYL)-2-PROPENOATE],(E)-;ACTEOSIDE;4-(3-(3,4-dihydroxyphenyl)-2-propenoate),(e)-beta-d-yl);glucopyranoside,
VERRUCAROL
CAS:2198-92-7
Formula: C15H22O4
266.33
ACM2198927
VERSICONOL
CAS:22268-13-9
ACM22268139
VERTEPORFIN
CAS:129497-78-5
Formula: C41H42N4O8
718.79
ACM129497785
Verteprofin; Verteporphin; trans-3,4-Dicarboxy-4,4a-dihydro-4a,8,14,19-tetramethyl-18-vinyl-23H,25H-benzo(b)porphine-9,13-dipropionic acid 3,4,9-trimethyl ester; Visudyne; VERTEPORFIN (200 MG);
VETIVEROL
CAS:68129-81-7
Formula: C15H24O
220.35
ACM68129817
VETIVEROL;lignolia;vetivenol;1,2,3,3a,4,5,6,8a-Octahydro-2-isopropylidene-4,8-dimethyl-6-azulenol;Vetivol;Einecs 268-578-9
VICTORIA BLUE 4R
CAS:2185-87-7
Formula: C34H34ClN3
520.12
ACM2185877
VICTORIA BLUE 4R;3,5-bis(1,1-dimethylethyl)-4-Benzenepropanoicacid;5-cyclohexadien-1-ylidene]-n-methyl-enyl]methylene]-chloride;methanaminium,n-[4-[[4-(dimethylamino)phenyl][4-(methylphenylamino)-1-naphthal;CI 42563;[4-[[4-(dimethylamino)phenyl][4-toluid
VICTORIA BLUE 4R
CAS:2185-87-7
Formula: C34H34ClN3
520.12
ACM2185877
VICTORIA BLUE 4R;3,5-bis(1,1-dimethylethyl)-4-Benzenepropanoicacid;5-cyclohexadien-1-ylidene]-n-methyl-enyl]methylene]-chloride;methanaminium,n-[4-[[4-(dimethylamino)phenyl][4-(methylphenylamino)-1-naphthal;CI 42563;[4-[[4-(dimethylamino)phenyl][4-toluid
VIDARABINE
CAS:5536-17-4
Formula: C10H13N5O4
267.24
ACM5536174
ARABINOSYL-ADENINE;6-AMINO-9-BETA-D-ARABINOFURANOSYLPURINE;ADENINE-BETA-D-ARABINOFURANOSIDE;ADENINE-9-BETA-D-ARABINOFURANOSIDE;9-BETA-D-ARABINOSYLADENINE;9-BETA-D-ARABINOFURANOSYLADENINE;2-ARAADENOSINE;SPONGOADENOSINE
VILDAGLIPTIN
CAS:274901-16-5
Formula: C17H25N3O2
303.4
ACM274901165
Unii-I6B4B2U96p; Laf 237; Galvus;
VILLOUS AMOMUM FRUIT EXTRACT
ACM-00003413
VINCAMINE
CAS:1617-90-9
Formula: C21H26N2O3
354.44
ACM1617909
(+)-cis-Vincamine;(3alpha,14beta,16alpha)-14,15-Dihydro-14-hydroxyeburnamenine-14-carboxylic acidmethyl ester;(3alpha,14beta,16alpha)-Dihydro-14-hydroxyeburnamenine-14-carboxylic acid methyl ester;14,15-Dihydro-14-hydroxyeburnamenine-14-carboxylic acid me
VINFOSILTINE
CAS:123286-00-0
Formula: C51H72N5O10P
946.129
ACM123286000
Vinfosiltine;4-O-Deacetyl-23-demethoxy-23-[[(S)-2-methyl-1-(diethoxyphosphinyl)propyl]amino]vincaleukoblastine
VINORELBINE
CAS:71486-22-1
Formula: C45H54N4O8
778.93
ACM71486221
3',4'-didehydro-4'-deoxy-c'-norvincaleukoblastin;nor-5'-anhydrovinblastine;VINORELBINE;Aspidospermidine-3-carboxylic acid, 4-(acetyloxy)-6,7-didehydro-15-[(2R,6R,8S)-4-ethyl-1,3,6,7,8,9-hexahydro-8-(methoxycarbonyl)-2,6-methano-2H-azecino[4,3-b]indol-8-yl
VINYL ACRYLATE CONTAINS
CAS:2177-18-6
Formula: C5H6O2
98.10
ACM2177186
VINYL ACRYLATE;2-propenoicacid,ethenylester;Acrylic acid, vinyl ester;acrylicacid,vinylester;ethenyl2-propenoate;VINYL ACRYLATE 98%;Vinyl acrylate, stabilized, 98+%;3-Oxahexa-1,5-diene-4-one
VINYL BENZOATE
CAS:769-78-8
Formula: C6H5CO2CH=CH2
148.2
ACM769788
BENZOIC ACID VINYL ESTER;VINYL BENZOATE;VINYL BENZOATE, 99+%;VINYL BENZOATE, STAB.;Benzoic acid, ethenyl ester (9CI);BENZOIC ACID VINYL ESTER (STABILIZED WITH HQ);Vinyl Benzoate (stabilized with MEHQ);Benzoic acid vinyl
VINYL BENZOATE
CAS:769-78-8
Formula: C6H5CO2CH=CH2
148.2
ACM769788
BENZOIC ACID VINYL ESTER;VINYL BENZOATE;VINYL BENZOATE, 99+%;VINYL BENZOATE, STAB.;Benzoic acid, ethenyl ester (9CI);BENZOIC ACID VINYL ESTER (STABILIZED WITH HQ);Vinyl Benzoate (stabilized with MEHQ);Benzoic acid vinyl
VINYL BROMOACETATE
CAS:5309-70-6
Formula: C4H5BrO2
164.99
ACM5309706
bromoacetic acid allyl ester; Brom-essigsaeure-p-tolylester; p-Tolyl-bromacetat; Brom-essigsaeure-vinylester; vinylbromoacetate; bromo-acetic acid vinyl ester; bromo-acetic acid p-tolyl ester; Acetic acid,bromo-,4-methylphenyl ester;
VINYL CHLORIDE/VINYL ACETATE COPOLYMER
CAS:9003-22-9
Formula: [-CH2CH(Cl)-]x[-CH2CH(O2CCH3)-]y
115000
ACM9003229
VINYL CHLORIDE/VINYL ACETATE/MALEIC ACID TERPOLYMERS,MW 30000
CAS:9005-09-8
30000
ACM9005098-1
VINYL CHLORIDE/VINYL ACETATE/MALEIC ACID TERPOLYMERS,MW 70000
CAS:9005-09-8
Formula: C30H39Cl3O18X2
70000
ACM9005098
2-Butenedioicacid(Z)-,polymerwithchloroetheneandethenylacetate;poly(vinylchloride-co-vinylacetate-co-maleicac;polymerwithchloroetheneandethenylacetate;POLY(VINYL CHLORIDE/VINYL ACETATE/MALEIC ACID);POLY(VINYL CHLORIDE-CO-VINYL ACETATE-CO-MALEIC ACID);VIN
VINYL CHLOROFORMATE
CAS:5130-24-5
Formula: C3H3ClO2
106.51
ACM5130245
VINYL CHLOROFORMATE;VINYL CHLOROFORMATE, STAB.;VINYL CHLOROFORMATE STABILIZED 99%;Vinyl chloroformate, stabilized, 99%;Vinyl chloroformate 98%;VINYL CHLOROFORMATE, 99%, STABILIZED;Carbonochloridic acid ethenyl ester;Chloridocarbonic acid ethenyl ester
VINYL CINNAMATE
CAS:3098-92-8
Formula: C11H10O2
174.2
ACM3098928
VINYL CINNAMATE;CINNAMIC ACID VINYL ESTER;VINYL CINNAMATE, 95+%;VINYL CINNAMATE, 97%, STAB WITH CA 50PPM 4-METHOXYPHENOL;VINYL CINNAMATE, INHIBITOR MEHQ (50PPM);Vinyl Cinnamate (stabilized with MEHQ);3-Phenylacrylic acid vinyl ester;3-Phenylpropenoic acid
VINYL CINNAMATE
CAS:3098-92-8
Formula: C11H10O2
174.2
ACM3098928
VINYL CINNAMATE;CINNAMIC ACID VINYL ESTER;VINYL CINNAMATE, 95+%;VINYL CINNAMATE, 97%, STAB WITH CA 50PPM 4-METHOXYPHENOL;VINYL CINNAMATE, INHIBITOR MEHQ (50PPM);Vinyl Cinnamate (stabilized with MEHQ);3-Phenylacrylic acid vinyl ester;3-Phenylpropenoic acid
VINYL DECANOATE
CAS:4704-31-8
Formula: C12H22O2
198.3
ACM4704318
Decanoic acid, ethenyl ester;DECANOIC ACID VINYL ESTER;N-CAPRIC ACID VINYL ESTER;VINYL N-DECANOATE;VINYL DECANOATE;Capricacidvinylester;VinylDecenoate;Vinyl Decanoate (stabilized with MEHQ)
VINYL LAURATE
CAS:2146-71-6
Formula: C14H26O2
226.36
ACM2146716
VINYL LITHIUM
CAS:917-57-7
Formula: C2H3Li
33.99
ACM917577
VINYL LITHIUM;Ethenyllithium
VINYL LITHIUM
CAS:917-57-1
Formula: C2H3Li
33.98620
ACM917571
Lithium,ethenyl-(9CI); lithium,ethenyl; ethenyllithium; lithium,ethene; lithium ethene; lithium ethenide; Vinyllithium;
VINYL METHACRYLATE
CAS:4245-37-8
Formula: C6H8O2
112.13
ACM4245378
METHACRYLIC ACID VINYL ESTER;VINYL METHACRYLATE;VINYL METHACRYLATE, 98%, STAB. WITH 200PPM 4-METHOXYPHENOL;METHACRYLIC ACID VINYL ESTER (STABILIZED WITH MEHQ) 98+%;Vinylmethacrylate,98%;2-PROPENOICACID,2-METHYL-,ETHENYLESTER;METHACRYLIC ACID VINYL ESTER(S
VINYL NEODECANOATE
CAS:51000-52-3
Formula: C12H22O2
198.3
ACM51000523
VINYL NEODECANOATE
CAS:51000-52-3
Formula: C12H22O2
198.3
ACM51000523
VINYL PIVALATE
CAS:3377-92-5
128.17
ACM3377925
VINYL PIVALATE
CAS:3377-92-2
Formula: C7H12O2
128.17
ACM3377922
(g)propanoicacid,2,2-dimethyl-,ethenylester;2,2-dimethyl-propanoicaciethenylester;ethenyl2,2-dimethylpropanoate;propanoicacid,2,2-dimethyl-,ethenylester;veova5;Vinyl-2,2-dimethylpropionate;vynateneo5;PIVALIC ACID VINYL ESTER
VINYL PROPIONATE
CAS:105-38-4
Formula: C5H8O2
100.12
ACM105384
Ethenylpropanoate;Propanoicacid,ethenylester;vinyl;Vinylester kyseliny propionove;vinylesterkyselinypropionove;vinylpropanoate;VINYL PROPIONATE;PROPIONIC ACID VINYL ESTER
VINYL PROPIONATE
CAS:105-38-4
Formula: C5H8O2
100.12
ACM105384
Ethenylpropanoate;Propanoicacid,ethenylester;vinyl;Vinylester kyseliny propionove;vinylesterkyselinypropionove;vinylpropanoate;VINYL PROPIONATE;PROPIONIC ACID VINYL ESTER
VINYL STEARATE,MIN. 95%
CAS:111-63-7
Formula: CH3(CH2)16CO2CH=CH2
310.5
ACM111637
STEARIC ACID VINYL ESTER;VINYL STEARATE;Octadecanoicacid,ethenylester;Stearic Acid Vinyl Ester (stabilized with MEHQ);Stearicacidethylester,stabilizedwithMEHQ;VINYL STEARATE, INHIBITOR MEHQ (20PPM);ethenyl octadecanoate;Vinyl Stearate (stabilized with MEH
VINYL TERMINATED DIPHENYLSILOXANE,DIMETHYLSILOXANE COPOLYMER
CAS:68951-96-2
ACM68951962
SiloxanesandSilicones,di-Me,di-Ph,vinylgroup-terminated;POLY(DIMETHYLSILOXANE-CO-DIPHENYLSILOXANE), DIVINYL TERMINATED;VINYL TERMINATED DIPHENYLSILOXANE, DIMETHYLSILOXANE COPOLYMER;Diphenylsiloxane - dimethylsiloxane vinyl terminated copolymer;Diphenylsil
VINYL TERMINATED POLYDIMETHYLSILOXANE
CAS:68083-19-2
Formula: N/A
ACM68083192
dowcorning3-4939;dowcorning6646;ge3175;Polydimethylsiloxane,vinylendblocked;ps441;ps442;ps448;SiloxanesandSilicones,di-Me,vinylgroup-terminated
VINYL TERMINATED TRIFLUOROPROPYLMETHYLSILOXANE,DIMETHYLSILOXANE COPOLYMER
CAS:68951-98-4
0
ACM68951984
VINYL TERMINATED TRIFLUOROPROPYLMETHYLSILOXANE, DIMETHYLSILOXANE COPOLYMER;siloxanesandsilicones,di-me,me3,3,3-trifluoropropyl,vinylgroup-terminate;SiloxanesandSilicones,di-Me,Me3,3,3-trifluoropropyl,vinylgroup-terminated;VINYL TERMINATED (35-45% TRIFLUOR
VINYL TRIFLUOROACETATE
CAS:433-28-3
Formula: C4H3F3O2
140.06
ACM433283
Acetic acid, trifluoro-, ethenyl ester;TRIFLUOROACETIC ACID VINYL ESTER;VINYL TRIFLUOROACETATE;Vinyl trifluoroacetate 98%;Vinyltrifluoroacetate98%;Vinyl trifluoroacetate, 99%, stab. with ca 10ppm 3,5-di-tert-butylcatechol;Trifluoroacetic acid ethenyl este
VINYL VALERATE
CAS:5873-43-8
Formula: C7H12O2
128.17
ACM5873438
VINYL VALERATE;VINYL N-VALERATE;Vinyl pentanoate;Pentanoic acid vinyl ester;Valeric acid ethenyl ester;Valeric acid vinyl ester;Vinyl pivalate;Einecs 227-533-3
VINYL VALERATE
CAS:5873-43-8
Formula: C7H12O2
128.17
ACM5873438
VINYL VALERATE;VINYL N-VALERATE;Vinyl pentanoate;Pentanoic acid vinyl ester;Valeric acid ethenyl ester;Valeric acid vinyl ester;Vinyl pivalate;Einecs 227-533-3
VINYL(3,3,3-TRIFLUOROPROPYL)DIMETHYLSILANE
CAS:84442-77-3
Formula: C7H13F3Si
182.26
ACM84442773
AKOS006343237, VINYL(3,3,3-TRIFLUOROPROPYL)DIMETHYLSILANE, 84442-77-3
VINYL(3,3,3-TRIFLUOROPROPYL)DIMETHYLSILANE
CAS:84442-77-3
Formula: C7H13F3Si
182.26
ACM84442773
AKOS006343237, VINYL(3,3,3-TRIFLUOROPROPYL)DIMETHYLSILANE, 84442-77-3
VINYL(BROMOMETHYL)DIMETHYLSILANE
CAS:211985-18-1
Formula: C5H11BrSi
179.13
ACM211985181
VINYL(BROMOMETHYL)DIMETHYLSILANE;
VINYL(BROMOMETHYL)DIMETHYLSILANE
CAS:211985-18-1
Formula: C5H11BrSi
179.13
ACM211985181
VINYL(BROMOMETHYL)DIMETHYLSILANE;
VINYL-1,1,3,3-TETRAMETHYLDISILOXANE
CAS:55967-52-7
Formula: C6H16OSi2
160.36
ACM55967527
1,1,3,3-tetramethyl-1-vinyldisiloxane; Disiloxane,1-ethenyl-1,1,3,3-tetramethyl; 1,1,3,3-Tetramethyl-1-vinylpropanedisiloxane; 1-Vinyl-1,1,3,3-tetramethylpropanedisiloxane; 1-vinyl-1,1,3,3-tetramethyldisiloxane;
VINYL-1,1,3,3-TETRAMETHYLDISILOXANE
CAS:55967-52-7
Formula: C6H16OSi2
160.36
ACM55967527
1,1,3,3-tetramethyl-1-vinyldisiloxane; Disiloxane,1-ethenyl-1,1,3,3-tetramethyl; 1,1,3,3-Tetramethyl-1-vinylpropanedisiloxane; 1-Vinyl-1,1,3,3-tetramethylpropanedisiloxane; 1-vinyl-1,1,3,3-tetramethyldisiloxane;
VINYL-13C2 ACETATE,99 ATOM % 13C
CAS:106139-40-6
Formula: 13C2C2H6O2
88.07
ACM106139406
Vinyl-13C2 acetate, 493481_ALDRICH, 106139-40-6
VINYL-T-BUTYLDIMETHYLSILANE
CAS:24858-02-4
Formula: C8H18Si
142.31
ACM24858024
Silane,(1,1-dimethylethyl)ethenyldimethyl; VINYL-T-BUTYLDIMETHYLSILANE; tert.Butyl-dimethyl-vinylsilan; vinyl-tert-butyldimethylsilane; (tert-Butyldimethylsilyl)ethene;
VINYL-T-BUTYLDIMETHYLSILANE
CAS:24858-02-4
Formula: C8H18Si
142.31
ACM24858024
Silane,(1,1-dimethylethyl)ethenyldimethyl; VINYL-T-BUTYLDIMETHYLSILANE; tert.Butyl-dimethyl-vinylsilan; vinyl-tert-butyldimethylsilane; (tert-Butyldimethylsilyl)ethene;
VINYLBENZENESULFONIC ACID
CAS:26914-43-2
Formula: C8H8O3S
184.212320 [g/mol]
ACM26914432
2-ethenylbenzenesulfonic acid, 2-vinylbenzenesulfonic acid, 50851-57-5, Ethenylbenzenesulfonic acid homopolymer, Vinylbenzenesulphonic acid, AC1Q6WT5, AC1L528M, CTK1H3104, EINECS 248-104-7, AR-1E5650, AG-E-85307, Benzenesulfonic acid, ethenyl-, homopolyme
VINYLBENZYL CHLORIDE PURUM,MIXTURE OF ISOMERS
CAS:30030-25-2
152.62
ACM30030252-2
VINYLBENZYLOXY)TRIMETHYLSILANE
CAS:112270-66-3
Formula: C12H18OSi
206.36
ACM112270663
VINYLBENZYLOXY)TRIMETHYLSILANE
CAS:112270-66-3
Formula: C12H18OSi
206.36
ACM112270663
VINYLCARBAZOLE
CAS:1484-13-5
Formula: C14H11N
193.25
ACM1484135
9-VINYLCARBAZOLE;9-VINYLCARBAZOLE MONOMER;N-VINYLCARBAZOLE;N-VINYLCARBAZOLE MONOMER;9-ethenyl-9h-carbazol;9-ethenyl-9h-carbazole;9-vinyl-carbazol;n-ethenylcarbazole
VINYLCARBAZOLE
CAS:1484-13-5
Formula: C14H11N
193.25
ACM1484135
9-VINYLCARBAZOLE;9-VINYLCARBAZOLE MONOMER;N-VINYLCARBAZOLE;N-VINYLCARBAZOLE MONOMER;9-ethenyl-9h-carbazol;9-ethenyl-9h-carbazole;9-vinyl-carbazol;n-ethenylcarbazole
VINYLCYCLOHEXANE
CAS:695-12-5
Formula: C8H14
110.2
ACM695125
VINYLCYCLOHEXANE;1-Vinylcyclohexane;Cyclohexane, vinyl-;cyclohexane,ethenyl-;Cyclohexane,ethenyl-(9CI);Cyclohexane,vinyl-;Cyclohexylethene;ethenyl-cyclohexan
VINYLCYCLOOCTANE
CAS:61142-41-4
Formula: C10H18
138.25
ACM61142414
Vinylcyclooctane, Cyclooctane, ethenyl-, 94959_ALDRICH, 94959_FLUKA, MolPort-000-005-854, CID93331, EINECS 262-623-6, 61142-41-4
VINYLCYCLOPENTANE
CAS:3742-34-5
Formula: C7H12
96.17
ACM3742345
Cyclopentane, vinyl-;Cyclopentylethylene;Ethenylcyclopentane;VINYLCYCLOPENTANE;ETHENE-1-CYCLOPENTYL;1-Vinylcyclopentane
VINYLDI-N-OCTYLMETHYLSILANE
CAS:475213-01-5
Formula: C19H40Si
296.61
ACM475213015
VINYLDI-N-OCTYLMETHYLSILANE
CAS:475213-01-5
Formula: C19H40Si
296.61
ACM475213015
VINYLDIETHYLMETHYLSILANE
CAS:18292-29-0
Formula: C7H16Si
128.2874
ACM18292290
Silane, diethylmethylvinyl-, Silane, ethenyldiethylmethyl-, DIETHYLMETHYLVINYLSILANE, MolPort-000-005-858, CID29020, 18292-29-0
VINYLDIETHYLMETHYLSILANE
CAS:18292-29-0
Formula: C7H16Si
128.2874
ACM18292290
Silane, diethylmethylvinyl-, Silane, ethenyldiethylmethyl-, DIETHYLMETHYLVINYLSILANE, MolPort-000-005-858, CID29020, 18292-29-0
VINYLDIMETHYLETHOXYSILANE
CAS:5356-83-2
Formula: C6H14OSi
130.26
ACM5356832
ethenyl-ethoxy-dimethylsilane; Ethoxydimethyl(vinyl)silane; DiMethylethoxyvinylsilane;
VINYLDIMETHYLETHOXYSILANE
CAS:5356-83-2
Formula: C6H14OSi
130.26
ACM5356832
ethenyl-ethoxy-dimethylsilane; Ethoxydimethyl(vinyl)silane; DiMethylethoxyvinylsilane;
VINYLDIPHENYLCHLOROSILANE
CAS:18419-53-9
Formula: C14H13ClSi
244.79
ACM18419539
diphenylvinylsilyl chloride; Vinyldiphenylchlorosilane; Ph2(vinyl)SiCl; Diphenylvinylchlorosilane; Silane,chlorodiphenylvinyl; chlorodiphenyl(vinyl)silane; Silane,chloroethenyldiphenyl; chloranyl-ethenyl-diphenyl-silane;
VINYLDIPHENYLCHLOROSILANE
CAS:18419-53-9
Formula: C14H13ClSi
244.79
ACM18419539
diphenylvinylsilyl chloride; Vinyldiphenylchlorosilane; Ph2(vinyl)SiCl; Diphenylvinylchlorosilane; Silane,chlorodiphenylvinyl; chlorodiphenyl(vinyl)silane; Silane,chloroethenyldiphenyl; chloranyl-ethenyl-diphenyl-silane;
VINYLDIPHENYLETHOXYSILANE
CAS:17933-85-6
Formula: C16H18OSi
254.4
ACM17933856
Silane,ethenylethoxydiphenyl; Ethoxydiphenylvinylsilan; Diphenylvinylethoxysilane; Aethoxy-diphenyl-vinyl-silan; vinyldiphenylethoxysilane; (Ethoxy)diphenylvinylsilane; Ethenyl-ethoxy-diphenyl-silane;
VINYLDIPHENYLETHOXYSILANE
CAS:17933-85-6
Formula: C16H18OSi
254.4
ACM17933856
Silane,ethenylethoxydiphenyl; Ethoxydiphenylvinylsilan; Diphenylvinylethoxysilane; Aethoxy-diphenyl-vinyl-silan; vinyldiphenylethoxysilane; (Ethoxy)diphenylvinylsilane; Ethenyl-ethoxy-diphenyl-silane;
VINYLEC K
CAS:63148-64-1
ACM63148641
VINYLENE CARBONATE
CAS:872-36-6
Formula: C3H2O3
86.05
ACM872366
1,3-DIOXOL-2-ONE;1,3-Dioxo-2-one;VINYLENE CARBONATE;Carbonic acid, cyclic vinylene ester;carbonicacid,cyclicvinyleneester;Vinylene carbonate (stabilized with HQ);Vinylenecarbonate,97%;VINYLENE CARBONATE, STAB.
VINYLFERROCENE
CAS:1271-51-8
Formula: C12H12Fe
212.07
ACM1271518
VINYLIDENE BROMIDE
CAS:593-92-0
Formula: C2H2Br2
185.85
ACM593920
1,1-dibromo-ethen;1,1-dibromoethene;1,1-dibromo-ethylen;Ethylene, 1,1-dibromo-;gem-dibromoethylene;1,1-DIBROMOETHYLENE;VINYLIDENE BROMIDE
VINYLIDENE CHLORIDE LATEX
CAS:9002-85-1
Formula: C2H2Cl2
0
ACM9002851
VINYLIDENE CHLORIDE LATEX;1,1-dichloro-ethenhomopolymer;Ethene,1,1-dichloro-,homopolymer;Poly(vinylidenechloride)resin;polyvinylidene;polyvinylidenechloride;1,1-Dichloroethylene polymer;vinylidene chloride homopolymer
VINYLIDENE CHLORIDE/VINYL CHLORIDE COPOLYMER
CAS:9011-06-7
165000
ACM9011067
VINYLIDENECYCLOHEXANE
CAS:5664-20-0
Formula: C8H12
108.18
ACM5664200
Ethenylidenecyclohexane, Cyclohexane,ethenylidene-, 5664-20-0, Vinylidenecyclohexane, vinylidene-cyclohexane, Cyclohexylideneethylene, Cyclohexane, ethenylidene-, AC1L3D2P, AKOS015906791, I14-21427
VINYLIDENECYCLOHEXANE
CAS:5664-20-0
Formula: C8H12
108.18
ACM5664200
Ethenylidenecyclohexane, Cyclohexane,ethenylidene-, 5664-20-0, Vinylidenecyclohexane, vinylidene-cyclohexane, Cyclohexylideneethylene, Cyclohexane, ethenylidene-, AC1L3D2P, AKOS015906791, I14-21427
VINYLIMIDAZOLE
CAS:1072-63-5
Formula: C5H6N2
94.11
ACM1072635
VINYLMETHYLBIS(METHYLETHYLKETOXIMINO)SILANE
CAS:73160-32-4
Formula: C11H22N2O2Si
242.39
ACM73160324
VINYLMETHYLBIS(METHYLETHYLKETOXIMINO)SILANE
CAS:73160-32-4
Formula: C11H22N2O2Si
242.39
ACM73160324
VINYLMETHYLBIS(METHYLETHYLKETOXIMINO)SILANE
CAS:72721-10-9
Formula: C11H22N2O2Si
242.39
ACM72721109
VINYLMETHYLBIS9METHYLETHYLKETOXIMINO)SILANE;
VINYLMETHYLBIS(METHYLETHYLKETOXIMINO)SILANE
CAS:72721-10-9
Formula: C11H22N2O2Si
242.39
ACM72721109
VINYLMETHYLBIS9METHYLETHYLKETOXIMINO)SILANE;
VINYLMETHYLDIACETOXYSILANE
CAS:2944-70-9
Formula: C7H12O4Si
188.25
ACM2944709
METHYLVINYLDIACETOXYSILANE; Silanediol,ethenylmethyl-,diacetate; Diacetoxymethylvinylsilan; ethenylmethyl-silanediodiacetate; vinyl methyl diacetoxysilane; diacetoxymethylvinylsilane; VinylmethyldiacetoxysilaneMethylvinyldiacetoxysilane;
VINYLMETHYLDIACETOXYSILANE
CAS:2944-70-9
Formula: C7H12O4Si
188.25
ACM2944709
METHYLVINYLDIACETOXYSILANE; Silanediol,ethenylmethyl-,diacetate; Diacetoxymethylvinylsilan; ethenylmethyl-silanediodiacetate; vinyl methyl diacetoxysilane; diacetoxymethylvinylsilane; VinylmethyldiacetoxysilaneMethylvinyldiacetoxysilane;
VINYLMETHYLDIMETHOXYSILANE
CAS:16753-62-1
Formula: C5H12O2Si
132.23
ACM16753621
DIMETHOXYMETHYLVINYLSILANE;METHYLVINYLDIMETHOXYSILANE;VINYLMETHYLDIMETHOXYSILANE;ethenyldimethoxymethyl-silan;ethenyldimethoxymethyl-Silane;Ethenylmethyldimethoxysilane;Silane, ethenyldimethoxymethyl-;Methyldimethoxyvinylsilane
VINYLMETHYLDIMETHOXYSILANE
CAS:16753-62-1
Formula: C5H12O2Si
132.23
ACM16753621
DIMETHOXYMETHYLVINYLSILANE;METHYLVINYLDIMETHOXYSILANE;VINYLMETHYLDIMETHOXYSILANE;ethenyldimethoxymethyl-silan;ethenyldimethoxymethyl-Silane;Ethenylmethyldimethoxysilane;Silane, ethenyldimethoxymethyl-;Methyldimethoxyvinylsilane
VINYLMETHYLSILOXANE HOMOPOLYMER
CAS:131298-48-1
Formula: C3H10O2Si2
134.2813
ACM131298481
siloxanesandsilicones,methoxyvinyl;POLY(VINYLMETHOXYSILOXANE);VINYLMETHYLSILOXANE HOMOPOLYMER;VINYLMETHOXYSILOXANE HOMOPOLYMER;VINYLMETHOXYSILOXANE HOMOPOLYMERS;VinylmethoxysiloxanehomopolymerviscositycSt;Vinylmethoxysiloxane;Vinyltrimethoxysiloxanehomopo
VINYLNEONONANOATE
CAS:54423-67-5
Formula: C11H20O2
184.28
ACM54423675
VINYL NEONONANOATE;Neononanoicacid,ethenylester;vinylneononanoate,mixtureofisomers;NEONONOICACID,VINYLESTER;Vinylneononanoat
VINYLOCTYLDICHLOROSILANE
CAS:211985-85-2
Formula: C10H20Cl2Si
239.25700
ACM211985852
Silane,dichloroethenyloctyl;
VINYLOCTYLDICHLOROSILANE
CAS:211985-85-2
Formula: C10H20Cl2Si
239.25700
ACM211985852
Silane,dichloroethenyloctyl;
VINYLPENTAMETHYLDISILOXANE
CAS:1438-79-5
Formula: C7H18OSi2
174.39
ACM1438795
Disiloxane,ethenylpentamethyl; Pentamethyl-vinyl-disiloxan; dimethyl(trimethylsiloxy)vinylsilane; VINYLPENTAMETHYLDISILOXANE; 1,1,3,3,3-pentamethyl-1-vinyldisiloxane; pentamethyl-vinyl-disiloxane; vinyldimethyisiloxytrimethylsilane; 1-vinyl-1,1,3,3,3-pent
VINYLPENTAMETHYLDISILOXANE
CAS:1438-79-5
Formula: C7H18OSi2
174.39
ACM1438795
Disiloxane,ethenylpentamethyl; Pentamethyl-vinyl-disiloxan; dimethyl(trimethylsiloxy)vinylsilane; VINYLPENTAMETHYLDISILOXANE; 1,1,3,3,3-pentamethyl-1-vinyldisiloxane; pentamethyl-vinyl-disiloxane; vinyldimethyisiloxytrimethylsilane; 1-vinyl-1,1,3,3,3-pent
VINYLPHENYLDICHLOROSILANE
CAS:7719-02-0
Formula: C8H8Cl2Si
203.14
ACM7719020
Vinyl-phenyl-dichlorsilan; dichloroethenylphenyl-silan; PHENYLVINYLDICHLOROSILANE; dichloro-phenyl-vinylsilane; ethenyl(phenyl)dichlorosilane;
VINYLPHENYLDICHLOROSILANE
CAS:7719-02-0
Formula: C8H8Cl2Si
203.14
ACM7719020
Vinyl-phenyl-dichlorsilan; dichloroethenylphenyl-silan; PHENYLVINYLDICHLOROSILANE; dichloro-phenyl-vinylsilane; ethenyl(phenyl)dichlorosilane;
VINYLPHENYLDIETHOXYSILANE
CAS:40195-27-5
Formula: C12H18O2Si
222.36
ACM40195275
1-trimethylsiloxy-3-phenyl-1-propene; Silane,ethenyldiethoxyphenyl; phenylketene methyl trimethysilyl acetal; VINYLPHENYLDIETHOXYSILANE; phenylketene methyl trimethylsilyl acetal;
VINYLPHENYLDIETHOXYSILANE
CAS:40195-27-5
Formula: C12H18O2Si
222.36
ACM40195275
1-trimethylsiloxy-3-phenyl-1-propene; Silane,ethenyldiethoxyphenyl; phenylketene methyl trimethysilyl acetal; VINYLPHENYLDIETHOXYSILANE; phenylketene methyl trimethylsilyl acetal;
VINYLPHENYLDIMETHYLSILANE
CAS:1125-26-4
Formula: C10H14Si
162.3
ACM1125264
CH2CHSiMe2Ph; Phenyldimethylvinylsilane; Vinylphenyldimethylsilane; Vinyldimethylphenylsilane; Me2PhSiCHCH2; PhMe2SiCH=CH2;
VINYLPHENYLDIMETHYLSILANE
CAS:1125-26-4
Formula: C10H14Si
162.3
ACM1125264
CH2CHSiMe2Ph; Phenyldimethylvinylsilane; Vinylphenyldimethylsilane; Vinyldimethylphenylsilane; Me2PhSiCHCH2; PhMe2SiCH=CH2;
VINYLPHENYLMETHYLMETHOXYSILANE
CAS:80252-60-4
Formula: C10H14OSi
178.3
ACM80252604
VINYLPHENYLMETHYLMETHOXYSILANE, 80252-60-4, SureCN296249, Vinylphenylmethyl methoxysilane, KB-62263
VINYLPHENYLMETHYLMETHOXYSILANE
CAS:80252-60-4
Formula: C10H14OSi
178.3
ACM80252604
VINYLPHENYLMETHYLMETHOXYSILANE, 80252-60-4, SureCN296249, Vinylphenylmethyl methoxysilane, KB-62263
VINYLPHENYLMETHYLSILANE
CAS:17878-39-6
Formula: C9H12Si
148.28
ACM17878396
Methylphenylvinylsilane, Phenylmethylvinylsilane, Silane, ethenylmethylphenyl-, Benzene, (ethenylmethylsilyl)-, 655473_ALDRICH, EINECS 241-830-5, Methylphenylvinylsilane, polymer-bound, CID6329252, 147377-51-3, 17878-39-6
VINYLPHENYLMETHYLSILANE
CAS:17878-39-6
Formula: C9H12Si
148.28
ACM17878396
Methylphenylvinylsilane, Phenylmethylvinylsilane, Silane, ethenylmethylphenyl-, Benzene, (ethenylmethylsilyl)-, 655473_ALDRICH, EINECS 241-830-5, Methylphenylvinylsilane, polymer-bound, CID6329252, 147377-51-3, 17878-39-6
VINYLPHOSPHONIC ACID
CAS:1746-03-8
Formula: C2H5O3P
108.03
ACM1746038
ethenephosphonicacid;ethenyl-phosphonicaci;ethenylphosphonicacid;ethylenephosphonicacid;vinyl-phosphonicaci;VINYLPHOSPHONIC ACID;VINYLPHOSPHONIC ACID 90 %, PURE;VINYLPHOSPHONIC ACID 65 %, TECHNICAL
VINYLPHOSPHONIC ACID
CAS:1746-03-8
Formula: C2H5O3P
108.03
ACM1746038
ethenephosphonicacid;ethenyl-phosphonicaci;ethenylphosphonicacid;ethylenephosphonicacid;vinyl-phosphonicaci;VINYLPHOSPHONIC ACID;VINYLPHOSPHONIC ACID 90 %, PURE;VINYLPHOSPHONIC ACID 65 %, TECHNICAL
VINYLPYRROLIDONE/STYRENE COPOLYMER
CAS:25086-29-7
Formula: C42H51N3O3X2
400000
ACM25086297
POLY(1-VINYLPYRROLIDONE-CO-STYRENE);N-VINYLPYRROLIDONE/STYRENE COPOLYMER;VINYL PYRROLIDONE/STYRENE LATEX;1-ethenyl-2-pyrrolidinonepolymerwithethenylbenzene;1-ethenyl-2-pyrrolidinonpolymerwithethenylbenzene;1-vinyl-2-pyrrolidinonepolymerwithstyrene;1-vinyl
VINYLPYRROLIDONE/VINYL ACETATE COPOLYMER,MW 13000
CAS:25086-89-9
13000
ACM25086899-2
VINYLPYRROLIDONE/VINYL ACETATE COPOLYMER,MW 2000
CAS:25086-89-9
2000
ACM25086899-5
VINYLPYRROLIDONE/VINYL ACETATE COPOLYMER,MW 2500
CAS:25086-89-9
2500
ACM25086899-6
VINYLPYRROLIDONE/VINYL ACETATE COPOLYMER,MW 3500
CAS:25086-89-9
3500
ACM25086899-4
VINYLSTEARATE
CAS:111-63-7
310.50
ACM111637-1
VINYLSULFINYL-BENZENE
CAS:20451-53-0
Formula: C8H8OS
152.21
ACM20451530
(Vinylsulfinyl)benzene;Sulfoxide, phenyl vinyl;PHENYL VINYL SULFOXIDE;VINYL PHENYL SULFOXIDE;phenyl vinyl sulphoxide;Benzene, (ethenylsulfinyl)-;NISTC20451530;(Ethenylsulfinyl)benzene
VINYLTRI-T-BUTOXYSILANE
CAS:5356-88-7
Formula: C14H30O3Si
274.47
ACM5356887
Silyl peroxide, Y-5712 silyl peroxide, Tris(tert-butoxy)vinylsilane, Silane, tri-tert-butoxyvinyl-, EINECS 226-343-8, MolPort-000-005-896, Tris(1,1-dimethylethoxy)ethenylsilane, CID79317, BRN 2210775, Silane, tris(1,1-dimethylethoxy)ethenyl-, Y 5712, LS-1
VINYLTRI-T-BUTOXYSILANE
CAS:5356-88-7
Formula: C14H30O3Si
274.47
ACM5356887
Silyl peroxide, Y-5712 silyl peroxide, Tris(tert-butoxy)vinylsilane, Silane, tri-tert-butoxyvinyl-, EINECS 226-343-8, MolPort-000-005-896, Tris(1,1-dimethylethoxy)ethenylsilane, CID79317, BRN 2210775, Silane, tris(1,1-dimethylethoxy)ethenyl-, Y 5712, LS-1
VINYLTRIETHYLGERMANE
CAS:6207-41-6
Formula: C8H18Ge
186.87
ACM6207416
VINYLTRIETHYLGERMANE
VINYLTRIISOPROPENOXYSILANE
226.34
ACM-00013807
VINYLTRIMETHOXYSILANE
CAS:2768-02-7
Formula: C5H12O3Si
148.24
ACM2768027
(TRIMETHOXYSILYL)ETHYLENE;TRIMETHOXYVINYLSILANE;VTMO;VINYLTRIMETHOXYSILANE;ETHENYLTRIMETHOXYSILAN;DOW CORNING(R) PRODUCT Q9-6300;(trimethoxysilyl)ethene;a171
VINYLTRIMETHYLAMMONIUM BROMIDE
CAS:10603-92-6
Formula: C5H12N.Br
166.06
ACM10603926
VINYLTRIMETHYLAMMONIUM BROMIDE
CAS:10603-92-6
Formula: C5H12N.Br
166.06
ACM10603926
VINYLTRIMETHYLSILANE
CAS:754-05-2
Formula: C5H12Si
100.23
ACM754052
CH2=CHSi(CH3)3;ethenyltrimethyl-silan;Silane, trimethylvinyl-;silane,trimethylvinyl-;Vinyltrimethysilane;VINYLTRIMETHYLSILANE;(TRIMETHYLSILYL)ETHYLENE;TRIMETHYLVINYLSILANE
VINYLTRIMETHYLSILANE
CAS:754-05-2
Formula: C5H12Si
100.23
ACM754052
CH2=CHSi(CH3)3;ethenyltrimethyl-silan;Silane, trimethylvinyl-;silane,trimethylvinyl-;Vinyltrimethysilane;VINYLTRIMETHYLSILANE;(TRIMETHYLSILYL)ETHYLENE;TRIMETHYLVINYLSILANE
VINYLTRIPHENYLPHOSPHONIUM BROMIDE
CAS:5044-52-0
Formula: C20H18PBr
369.23
ACM5044520
Triphenylvinylphosphonium Bromide; Schweizers; ethenyl(triphenyl)phosphanium,bromide; Ethenyltriphenylphosphonium bromide; Vinyltriphenylphosphonium Bromide; Schweizers;
VINYLTRIPHENYLPHOSPHONIUM BROMIDE
CAS:5044-52-0
Formula: C20H18PBr
369.23
ACM5044520
Triphenylvinylphosphonium Bromide; Schweizers; ethenyl(triphenyl)phosphanium,bromide; Ethenyltriphenylphosphonium bromide; Vinyltriphenylphosphonium Bromide; Schweizers;
VINYLTRIS(1-METHOXY-2-PROPOXY)SILANE
CAS:303746-21-6
Formula: C14H30O6Si
322.47
ACM303746216
7-ethenyl-7-(3-methoxypropoxy)-2,6,8,12-tetraoxa-7-silatridecane; Silane,ethenyltris(2-methoxymethylethoxy)-(9CI); 2,6,8,12-tetraoxa-7-silatridecane,7-ethenyl-7-(3-methoxypropoxy); 7-(3-Methoxypropoxy)-7-vinyl-2,6,8,12-tetraoxa-7-silatridecane;
VINYLTRIS(1-METHOXY-2-PROPOXY)SILANE
CAS:303746-21-6
Formula: C14H30O6Si
322.47
ACM303746216
7-ethenyl-7-(3-methoxypropoxy)-2,6,8,12-tetraoxa-7-silatridecane; Silane,ethenyltris(2-methoxymethylethoxy)-(9CI); 2,6,8,12-tetraoxa-7-silatridecane,7-ethenyl-7-(3-methoxypropoxy); 7-(3-Methoxypropoxy)-7-vinyl-2,6,8,12-tetraoxa-7-silatridecane;
VINYLTRIS(DIMETHYLSILOXY)SILANE
CAS:160172-46-3
Formula: C8H24O3Si4
280.62
ACM160172463
VINYLTRIS(DIMETHYLSILOXY)SILANE
CAS:160172-46-3
Formula: C8H24O3Si4
280.62
ACM160172463
VINYLTRIS(METHYLETHYLKETOXIME)SILANE
CAS:2224-33-1
Formula: C14H27N3O3Si
313.47
ACM2224331
VINYLTRIS(METHYLETHYLKETOXIME)SILANE
CAS:2224-33-1
Formula: C14H27N3O3Si
313.47
ACM2224331
VINYLTRIS(TRIMETHYLSILOXY)SILANE
CAS:5356-84-3
Formula: C11H30O3Si4
322.7
ACM5356843
Vinyltris(trimethylsilyloxy)silane; Vinyltris(trimethylsiloxy)silane ([Tris(trimethylsiloxy)silyl]ethylene; ethenyl-tris(trimethylsilyloxy)silane; 1,1,1,5,5,5-Hexamethyl-3-((trimethylsilyl)oxy)-3-vinyltrisiloxane;
VINYLTRIS(TRIMETHYLSILOXY)SILANE
CAS:5356-84-3
Formula: C11H30O3Si4
322.7
ACM5356843
Vinyltris(trimethylsilyloxy)silane; Vinyltris(trimethylsiloxy)silane ([Tris(trimethylsiloxy)silyl]ethylene; ethenyl-tris(trimethylsilyloxy)silane; 1,1,1,5,5,5-Hexamethyl-3-((trimethylsilyl)oxy)-3-vinyltrisiloxane;
VIOLACEIN
CAS:548-54-9
Formula: C20H13N3O3
343.34
ACM548549
VIOLANTHRONE-79
CAS:85652-50-2
Formula: C50H48O4
712.925
ACM85652502
VIOLAXANTHIN
CAS:126-29-4
Formula: C40H56O4
600.87
ACM126294
ZEAXANTHIN DIEPOXIDE;VIOLAXANTHIN;(1R,3S,6S)-6-[18-[(1R,3S,6S)-3-hydroxy-1,5,5-trimethyl-7-oxabicyclo[4.1.0]hept-6-yl]-3,7,12,16-tetramethyl-octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]-1,5,5-trimethyl-7-oxabicyclo[4.1.0]heptan-3-ol;Violoxanthin;(3S,3S,5R,5R,
VIOLURIC ACID MONOHYDRATE
CAS:26351-19-9
Formula: C4H5N3O5
175.1
ACM26351199
VIOMYCIN
CAS:32988-50-4
Formula: C25H43N13O10
685.696
ACM32988504
viomycin;FLORIMYCIN;Coliomycin;Tuberactinomycin B;Vinacetin A;Vioactane;Viocin;(S)-3,6-Diamino-N-((3S,9S,12S,15S,Z)3((2R,4S)-6-amino-4-hydroxy-1,2,3,4-tetrahydropyridin-2-yl)-9,12-bis(hydroxymethyl)-2,5,8,11,14-pentaoxo-6-(ureidomethylene)-1,4,7,10,13-pen
VIP
CAS:40077-57-4
Formula: C147H238N44O42S
3325.8
ACM40077574
VASOACTIVE INTESTINAL PEPTIDE (HUMAN, BOVINE, PORCINE, RAT);VASOACTIVE INTESTINAL PEPTIDE (HUMAN, PORCINE);VASOACTIVE INTESTINAL PEPTIDE, HUMAN, PORCINE, AND RAT;VASOACTIVE INTESTINAL PEPTIDE (HUMAN, PORCINE) (BOVINE, RAT, CANINE);VASOACTIVE INTESTINAL PE
VIQUALINE
CAS:72714-74-0
ACM72714740
VIQUIDIL
CAS:84-55-9
Formula: C20H24N2O2
324.422
ACM84559
viquidil;1-(6-Methoxy-4-quinolyl)-3-[(3R,4R)-3-vinyl-4-piperidinyl]-1-propanone;Chinicine;Quinotoxine;Quinotoxol;1-(6-methoxy-4-quinolyl)-3-[(3R,4R)-3-vinyl-4-piperidyl]propan-1-one;3-[(3R,4R)-3-ethenylpiperidin-4-yl]-1-(6-methoxyquinolin-4-yl)propan-1-on
VIRAMIDINE HYDROCHLORIDE
CAS:40372-00-7
Formula: C8H14ClN5O4
279.68
ACM40372007
1--D-Ribofuranosyl-1H-1,2,4-triazole-3-carboximidamide Monohydrochloride
VIRGINIAMYCIN S1
CAS:23152-29-6
Formula: C43H49N7O10
823.9
ACM23152296
VITAMIN A
CAS:68-26-8
Formula: C20H30O
286.45
ACM68268
(all-e)-3,7-dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraen;-1-ol;2,4,6,8-Nonatetraen-1-ol, 3,7-dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-, (all-E)-;21 CFR 182,5930;3,7-dimethyl-9-(2,6,6-trimethyl-1-cyclchexen-1-yl)-2,4,6,8-nonatet
VITAMIN B6
CAS:8059-24-3
Formula: C10H16N2O3S
244.31
ACM8059243
BIOEPIDERM;BIOS H;(+)-BIOTIN;BIOTIN;BIOTIN, IMMOBILIZED ON DEXTRAN;BIOTIN, IMMOBILIZED ON DEXTRAN-LYSINE;BIOTIN(V-H);BIOTINUM
VITAMIN D2
CAS:50-14-6
Formula: C28H44O
396.65
ACM50146
VITAMIN D;VITAMIN D2;VITAMIN D2 WATER;VIOSTEROL;(3beta,5Z,7E,22E)-9,10-Secoerga-5,7,10(19),22-tetraen-3-ol;(3beta,5Z,7E,22E)-9,10-Secoergosta-5,7,10(19)-,22-tetraen-3-ol;(3-beta,5z,7e,22e)-9,10-secoergosta-5,7,10,(19),22-tetraen-3-ol;(5E,7E,22E)-9,10-Seco
VITAMIN E NICOTINATE
CAS:16676-75-8
Formula: C35H53NO3
535.8
ACM16676758
tocopherylnicotinate,vitaminenicotinate;ALPHA-TOCOPHERYL NICOTINATE;[2,5,7,8-TETRAMETHYL-2-(4,8,12-TRIMETHYLTRIDECYL)CHROMAN-6-YL] PYRIDINE-3-CARBOXYLATE;(+/-)-2,5,7,8-Tetramethyl-2-(4,8,12 (-trimethyltridecyl)chromanol nicotinate;(+/-)-alpha-Tocopherol n
VITAMIN K2
CAS:11032-49-8
Formula: C31H40O2
444.65
ACM11032498
MENAQUINONE;MENAQUINONE 4;VITAMIN K2(MENAQUINONE)(PRIMARY STANDARD);VITAMIN K2(MENAQUINONE)(REAGENT / STANDARD GRADE);Menatetrenone=Menaquinon-4;VitaminK2(20),Menatetreone;Menaquinones;Vitamin K2
VITAMIN K5
CAS:83-70-5
Formula: C11H11NO
173.21
ACM83705
VITAMIN K5;1-hydroxy-2-methyl-4-aminonaphthalene;2-methyl-4-amino-1-hydroxynaphthalene;2-methyl-4-amino-1-naphthol;3-methyl-4-hydroxy-1-naphthylamine;4-amino-2-methyl-1-naphthaleno;4-amino-2-methyl-1-naphthalenol;4-amino-2-methyl-1-naphtho
VITAMIN-E
CAS:14638-18-7
Formula: C66H106CaO10
1099.62
ACM14638187
alpha-Tocopherolcalciumsuccinate;Tocopherol calcium succinate (JP14);Butanedioic acid, mono[3,4-dihydro-2,5,7,8-tetramethyl-2-(4,8,12-trimethyltridecyl)-2H-1-benzopyran-6-yl] ester, calcium salt (9CI);dl-a-Tocopherol calcium succinate;ALPHA-Tocopherol su
VITEXIN 4-O-GLUCOSIDE
CAS:178468-00-3
Formula: C27H30O15
594.52
ACM178468003
MolPort-019-936-744, Vitexin 4 inverted exclamation marka-O-glucoside, 178468-00-3, 4 inverted exclamation marka,5,7-Trihydroxyflavone 8-C-(4 inverted exclamation marka-glucosylglucoside)
VNPB
CAS:1010396-31-2
ACM1010396312
VOLAN(R) BONDING AGENT
CAS:111031-82-4
ACM111031824
VOMIFOLIOL
CAS:23526-45-6
Formula: C13H20O3
0
ACM23526456
VOMIFOLIOL;(1S)-1-Hydroxy-1-[(1E,3R)-3-hydroxy-1-butenyl]-2,6,6-trimethyl-2-cyclohexene-4-one;(S)-4-Hydroxy-4-[(R,E)-3-hydroxy-1-butenyl]-3,5,5-trimethyl-2-cyclohexen-1-one;Blumenol A;2-Cyclohexen-1-one,4-hydroxy-4-[(1E,3R)-3-hydroxy-1-buten-1-yl]-3,5,5-t
VOPC
CAS:13930-88-6
Formula: C32H16N8OV
579.47
ACM13930886
VANADYL(IV)-PHTHALOCYANINE;VANADYL PHTHALOCYANINE;VANADIUM(IV) OXIDE PHTHALOCYANINE;VOPC;31h-phthalocyaninato(2-)-n29,n39,n31,n32]-oxo[29(sp-5-12)-vanadiu;PHTHALOCYANINE, VANADYL;OXO(PHTHALOCYANINATO)VANADIUM(IV);Oxyvanadium phthalocyanine
VORAPAXAR SULFATE
CAS:705260-08-8
Formula: C29H35FN2O8S
590.6602032
ACM705260088
Vorapaxar Sulfate;N-[(1R,3aR,4aR,6R,8aR,9S,9aS)-9-[(1E)-2-[5-(3-Fluorophenyl)-2-pyridinyl]ethenyl]dodecahydro-1-Methyl-3-oxonaphtho[2,3-c]furan-6-yl]carbaMic Acid Ethyl Ester Sulfate;Sch 530348;SCH 530348 (H2SO4 Salt);vorapaxar impurity A;Carbamic acid, N
VORINOSTAT
CAS:149647-78-9
Formula: C14H20N2O3
264.32
ACM149647789
Octanediamide, N1-hydroxy-N8-phenyl-;SAHA=N-Hydroxy-N-phenyloctanediamide;SAHA, N-Hydroxy-Nphenyloctanediamide, Zolinza;Zolinza (See Suberoylanilide Hydroxamic Acid);Vorinostat;N-Hyrdroxy-N-phenyloctanediamide;Suberanilohydroxamic acid;Suberoylanilide hyd
VP/HEXADECENE COPOLYMER
CAS:32440-50-9
ACM32440509
VPHOS
492.72
ACM-00013493
VPHOS PD G3
862.45
ACM-00013889
VPHOS PD G4
CAS:1848244-57-4
876.47
ACM1848244574
VRT-532
CAS:38214-71-0
Formula: C16H14N2O
250.30
ACM38214710
4-Methyl-2-(5-phenyl-1H-pyrazol-3-yl)phenol, 38214-71-0, ZINC04576484, SureCN960647, SureCN9911652, AC1OA052, CTK8I5138, KB-39787, 4-methyl-6-(5-phenyl-1,2-dihydropyrazol-3-ylidene)cyclohexa-2,4-dien-1-one
VSE2 CRYSTAL
CAS:12299-51-3
ACM12299513
VU 0238429
CAS:1160247-92-6
Formula: C17H12F3NO4
351.28
ACM1160247926
1-[(4-methoxyphenyl)methyl]-5-(trifluoromethoxy)indole-2,3-dione;
VU0029767
CAS:326001-01-8
Formula: C21H21N3O3
363.41
ACM326001018
VU0029767, ZINC01204219, AC1O9GWE, CTK8E8154, 326001-01-8, KB-112477, 2-(4-ethoxyanilino)-N-[(2-oxonaphthalen-1-ylidene)methyl]acetohydrazide, 2-[(4-ethoxyphenyl)amino]-N-[(2-hydroxy-1-naphthyl)methylene]acetohydrazide
VU0155069
CAS:1130067-06-9
Formula: C26H27ClN4O2
C26H27CIN4O2.HCl
ACM1130067069
VU591
CAS:1222810-74-3
Formula: C16H12N6O5
368.30
ACM1222810743
CHEMBL2146753, ML112, VU591, VU0365318-1, 2,2 inverted exclamation marka-(oxydimethanediyl)bis(5-nitro-1H-benzimidazole), 2,2 inverted exclamation marka-(oxydimethanediyl)bis(6-nitro-1H-benzimidazole), 5-nitro-2-{[(6-nitro-1H-benzimidazol-2-yl)methoxy]met
VUF 5574
CAS:280570-45-8
Formula: C21H17N5O2
371.39
ACM280570458
VUF 8430 DIHYDROBROMIDE
CAS:100130-32-3
Formula: C4H13Br2N5S
323.05
ACM100130323
CID3063227, LS-126151, S,2-Guanidinoethylisothiuronium bromide hydrobromide, 2-(2-Guanidinoethyl)-2-thiopseudourea dihydrobromide, Pseudourea, 2-(2-guanidinoethyl)-2-thio-, dihydrobromide, Carbamimidothioic acid, 2-((aminoiminomethyl)amino)ethyl ester, di
W-7 HYDROCHLORIDE
CAS:61714-27-0
Formula: C16H22Cl2N2O2S
377.33
ACM61714270
W146 HYDRATE
CAS:909725-61-7
342.37 (anhydrous basis)
ACM909725617
WALPHOS SL-W001-2
CAS:849925-17-3
Formula: C46H32F12FeP2
930.52
ACM849925173
WALPHOS SL-W003-2
CAS:849925-19-5
Formula: C42H48FeP2
670.62
ACM849925195
Walphos SL-W003-2, 849925-19-5, Walphos SL-W003-1, 65676_ALDRICH, CTK8E6528, 388079-60-5, SC11463, RT-016250, (R)-(-)-1-[(R)-2-(2-DIPHENYLPHOSPHINOPHENYL)FERROCENYL]ETHYLDICYCLOHEXYLPHOSPHINE, (R)-1-[(R)-2-(2-DIPHENYLPHOSPHINO-PHENYL)-FERROCENYL]-ETHYL-DI
WALPHOS SL-W006-2
CAS:849925-21-9
Formula: C46H44FeP2
714.63
ACM849925219
Walphos SL-W006-2, 849925-21-9, Walphos SL-W006-1, 65680_ALDRICH, CTK8E6534, 494227-31-5, SC11469, RT-016251, (R)-1-[(R)-2-[2-(DIPHENYLPHOSPHINO)PHENYL]FERROCENYL]ETHYLDI(3,5-XYLYL)PHOSPHINE, (R)-(+)-1-[(R)-2-(2-DIPHENYLPHOSPHINOPHENYL)FERROCENYL]ETHYLDI(
WALPHOS SL-W022-1
CAS:849925-29-7
Formula: C44H48FeP2
694.64
ACM849925297
Walphos SL-W022-1, 849925-29-7, 65685_ALDRICH, CTK8E6523, RT-016252
WALPHOS SL-W022-2
CAS:849925-45-7
Formula: C44H48FeP2
694.64
ACM849925457
849925-45-7, CTK8E6835, RT-016253
WASA-YU MPAA LIGAND
CAS:1346641-35-7
460.73
ACM1346641357
WATER
CAS:7732-18-5
Formula: H2O
18.01
ACM7732185
ALKALINE TRANSFER SOLUTION;Liquid soda;LYE;DOCTOR SOLUTION;DOCTORS SOLUTION;DOCTORS SOLUTION;Dihydrogen oxide;dihydrogenoxide
WATER
CAS:7732-18-5
Formula: H2O
18.01
ACM7732185
ALKALINE TRANSFER SOLUTION;Liquid soda;LYE;DOCTOR SOLUTION;DOCTORS SOLUTION;DOCTORS SOLUTION;Dihydrogen oxide;dihydrogenoxide
WATER
CAS:13768-40-6
Formula: H2O
19.015012 [g/mol]
ACM13768406
WATER SOLUBLE NIGROSINE C.I.ACID BLACK 2
CAS:101357-32-8
ACM101357328
NIGROSINE, WATER SOLUBLE, C.I. 50420, FOR MICROSCOPY;enzene,sodiumsalts;sulfuricacid,reactionproductswithaniline,anilinehydrochlorideandnitrob;Sulfuric acid, reaction products with aniline, aniline hydrochloride and nitrobenzene, sodium salts;Solventblac
WAY 161503 HYDROCHLORIDE
CAS:276695-22-8
Formula: C11H12Cl3N3O
308.59
ACM276695228
8,9-DICHLORO-2,3,4,4A-TETRAHYDRO-1H-PYRAZINO[1,2-A]QUINOXALIN-5(6H)-ONE HYDROCHLORIDE, WAY161503 hydrochloride, SureCN1986324, WAY 161503 hydrochloride, MolPort-003-983-708, KB-62274, 276695-22-8, 75704-24-4
WAY 207024 DIHYDROCHLORIDE
CAS:872002-73-8
Formula: C30H32N6.2HCl
C30H32N6.2HCl
ACM872002738
WAY 208466 DIHYDROCHLORIDE
CAS:633304-27-5
Formula: C17H18FN3O2S2HCl
C17H18FN3O2S.2HCl
ACM633304275
WAY-100135
CAS:149055-79-8
Formula: C24H35Cl2N3O2
468.46
ACM149055798
Way-100135, AGN-PC-002LSR, (S)-N-TERT-BUTYL-3-(4-(2-METHOXYPHENYL)-PIPERAZIN-1-YL)-2-PHENYLPROPANAMIDE DIHYDROCHLORIDE, (+/-)-WAY 100135, 3-[4-(2-Methoxyphenyl)piperazin-1-yl]-2-phenyl-N-tert-butyl-propanamide dihydrochloride;, N-tert-Butyl-3-(4-(2-methox
WAY-100635 MALEATE
CAS:634908-75-1
Formula: C25H34N4O2??C4H4O4
538.64
ACM634908751
WHEAT OLIGOPEPTIDES
ACM-00003376
WHEAT PEPTONE
CAS:94350-06-8
ACM94350068
WHISKEY LACTONE
CAS:39212-23-2
Formula: C9H16O2
156.22
ACM39212232
WHISKEY LACTONE;WHISKY LACTONE;5-butyldihydro-4-methyl-2(3h)-furanon;FEMA 3803;METHYL OCTALACTONE;METHYL OCTALACTONE(TM);(+/-)-5-BUTYL-4-METHYLDIHYDRO-2(3H)-FURANONE;5-BUTYLDIHYDRO-4-METHYL-2(3H)-FURANONE
WHISKEY LACTONE
CAS:39212-23-2
Formula: C9H16O2
156.22
ACM39212232
WHISKEY LACTONE;WHISKY LACTONE;5-butyldihydro-4-methyl-2(3h)-furanon;FEMA 3803;METHYL OCTALACTONE;METHYL OCTALACTONE(TM);(+/-)-5-BUTYL-4-METHYLDIHYDRO-2(3H)-FURANONE;5-BUTYLDIHYDRO-4-METHYL-2(3H)-FURANONE
WHITE KIDNEY BEAN EXTRACT
ACM-00003486
White kidney bean extractive
WILD HONEYSUCKLE FLOWER P.E.
ACM-00003411
WILD YAM P.E.,DIOSGENIN,UV,40%
CAS:1372346-24-1
ACM1372346241
WILLOW BARK EXTRACT
CAS:84082-82-6
Formula: C13H18O7
ACM84082826
willow bark extract;Willow, Salix alba, ext.;SALIX ALBA (WILLOW) BARK EXTRACT;SALIX ALBA (WILLOW) LEAF EXTRACT;Salixpurpureaextract=willowextract/CH;Willowbark/Salixpurpureaextract;WILLOWBARKEXTRACT,POWDER;SALIXALBAEXTRACT
WILLOW, SALIX ALBA, EXT.
Formula: C13H18O7
286.27
ACM-00003458
WILLOW, SALIX CASPICA,EXT.
CAS:100299-04-5
ACM100299045
WIN 62,577 NOVEL NON-PEPTIDE NK-
CAS:138091-43-7
Formula: C29H31N3O
437.58
ACM138091437
HMS2234A21; 17-|A-Hydroxy-17-|A-ethynyl-|A-4-androstano[3,2-b]pyrimido[1,2-a]benzimidazole;
WITCAMIDE(R)511 EMULSIFIER
CAS:80893-63-6
ACM80893636
WITHAFERIN A
CAS:5119-48-2
Formula: C27H36O7
472.57
ACM5119482
WITHAFERIN A;5,6-beta-epoxy-4-beta,22,27-trihydroxy-1-5-beta-ergosta-24-dien-26-oicacid;delta-lactone,(20s,22r)-oxo;nsc-101088;withaferinea;(4,5,6,22R)-5,6-Epoxy-4,22,27-trihydroxy-1-oxoergosta-2,24-dien-26-oicacidd-lactone;NSC 273757;Withaferine
WITHANONE(SH)
CAS:27570-38-3
Formula: C28H38O6
470.61
ACM27570383
WITHANOSIDE IV
CAS:362472-81-9
Formula: C40H62O15
782.91
ACM362472819
Withanoside IV, (1|A,3|A,22R)-3-[(6-O-|A-D-Glucopyranosyl-|A-D-glucopyranosyl)oxy]-1,22,27-trihydroxy-ergosta-5,24-dien-26-oic acid |A-lactone, 362472-81-9
WITHANOSIDE V
CAS:256520-90-8
Formula: C40H62O14
766.91
ACM256520908
Withanoside V, (1|A,3|A,22R)-3-[(6-O-|A-D-Glucopyranosyl-|A-D-glucopyranosyl)oxy]-1,22-dihydroxy-ergosta-5,24-dien-26-oic acid |A-lactone, 256520-90-8
WITHASTRAMONOLIDE,12-DEOXY-(SH)
CAS:60124-17-6
Formula: C28H38O6
470.6
ACM60124176
WOLFBERRY EXTRACT
ACM-00003474
extractive from Barbury Wolfberry fruit P.E.
WOOD'S METAL
CAS:8049-22-7
Formula: BiCdPdSn
546.52
ACM8049227
WOODS ALLOY
CAS:76093-98-6
Formula: BiCdPdSn
546.52
ACM76093986
BISMUTH LEAD TIN CADMIUM;ALLOY ACCORDING TO WOOD;WOODS METAL;WOODS METAL;WOODS ALLOY;WOODS ALLOY;Alloy Woods
;WOODS METAL, STICK
WOODWARDIA JAPONICA EXTRACT
ACM-00003468
extractive from rhizoma cibotii
WOODWARDIC ACID
CAS:10-30-0
Formula: C30H48O3
456.7003
ACM10300
WORMSEED OIL
CAS:8024-11-1
0
ACM8024111
WORMSEED OIL;Oils, wormseed;ARTEMISIACINABERGOIL;American wormseed oil
WR99210
CAS:47326-86-3
Formula: C14H18Cl3N5O2
394.68
ACM47326863
1,6-Dihydro-6,6-dimethyl-1-[3-(2,4,5-trichlorophenoxy)propoxy]-1,3,5-triazine-2,4-diamine;
WRIGHT'S STAIN
CAS:68988-92-1
Formula: C36H27N3O5SBr4
. CODE
ACM68988921
WS-2
CAS:1263863-11-1
ACM1263863111
WS-5
CAS:1334739-85-3
ACM1334739853
WS2 CRYSTAL
CAS:12138-09-9
ACM12138099-5
WS2 MICROPOWDER
CAS:12138-09-9
ACM12138099-29
WS2 NANOSHEETS DISPERSION
CAS:12138-09-9
ACM12138099-16
WS2 POWDER 0.58?M
CAS:12138-09-9
ACM12138099-26
WS2 POWDER 0.88?M
CAS:12138-09-9
ACM12138099
WS2 POWDER 1.9?M
CAS:12138-09-9
ACM12138099-20
WS2 POWDER 100NM
CAS:12138-09-9
ACM12138099-22
WS2 POWDER 3.8?M
CAS:12138-09-9
ACM12138099-14
WS2 POWDER 5.0?M
CAS:12138-09-9
ACM12138099-12
WSE2 CRYSTAL
CAS:12067-46-8
Formula: Se2W
341.76
ACM12067468
TUNGSTEN DISELENIDE;TUNGSTEN (IV) SELENIDE;TUNGSTEN SELENIDE;TUNGSTEN (IV) SELENIDE, 99.8% (METALS BASIS);Tungsten(?) selenide
WSE2 CRYSTAL
CAS:12067-46-8
Formula: Se2W
341.76
ACM12067468
TUNGSTEN DISELENIDE;TUNGSTEN (IV) SELENIDE;TUNGSTEN SELENIDE;TUNGSTEN (IV) SELENIDE, 99.8% (METALS BASIS);Tungsten(?) selenide
WTE2 CRYSTAL
CAS:12067-76-4
ACM12067764
WWL70
CAS:947669-91-2
Formula: C27H23N3O3
C27H23N3O3
ACM947669912
X-1-ACETATE
CAS:125328-76-9
Formula: C10H7BrClNO2
288.53
ACM125328769
X80
CAS:292065-64-6
Formula: C23H15ClN2O6
450.83
ACM292065646
AC1NT6TZ, Ambcb6040912, CHEMBL520941, HMS598C17, AKOS000112732, CCG-222138, BIM-0041706.P001, 292065-64-6, 5-(5-{[1-(3-carboxyphenyl)-3-methyl-5-oxo-1,5-dihydro-4H-pyrazol-4-ylidene]methyl}-2-furyl)-2-chlorobenzoic acid, 5-[5-[(Z)-[1-(3-carboxyphenyl)-3-m
XAMOTEROL HEMIFUMARATE
CAS:73210-73-8
Formula: C36H54N6O14
794.85
ACM73210738
N-[2-[[2-hydroxy-3-(4-hydroxyphenoxy)propyl]amino]ethyl]morpholine-4-carboxamide
XANTHAMIDE 8
CAS:442151-56-6
Formula: C27H23NO6
457.47
ACM442151566-1
1-[2-(6-Methoxy-3-oxo-3H-xanthen-9-yl)-benzoyl]-piperidine-4-carboxylic acid
XANTHAN GUM
CAS:11138-66-2
Formula: C35H49O29
0
ACM11138662
GUM XANTHAN;GLUCOMANNAN;GLUCOMANNAN MAYO;GALACTOMANNANE;RHODOPOL 23;XANTHAN;XANTHAN GUM;XANTEMPO(TM)
XANTHENE-9-METHYLAMINE
CAS:100866-28-2
Formula: C14H13NO
211.26
ACM100866282
XANTHENE-9-METHYLAMINE HYDROCHLORIDE;XANTHENE-9-METHYLAMINE
XANTHINE SODIUM SALT
CAS:1196-43-6
Formula: C5H3N4NaO2
174.09
ACM1196436
XANTHOPTERIN MONOHYDRATE
CAS:5979-01-1
Formula: C6H7N5O3
197.15
ACM5979011
XANTHOSINE 5-MONOPHOSPHATE DISODIUM SALT
CAS:25899-70-1
Formula: C10H11N4Na2O9P
408.17
ACM25899701
XMP;XMP DISODIUM SALT;XMP, NA2;XMP SODIUM SALT;XANTHOSINE 5-MONOPHOSPHATE DISODIUM;XANTHOSINE 5-MONOPHOSPHATE DISODIUM SALT;XANTHOSINE 5-MONOPHOSPHATE SODIUM SALT;XANTHOSINE-5-MONOPHOSPHORIC ACID, DISODIUM
XANTHURENIC ACID
CAS:59-00-7
Formula: C10H7NO4
205.17
ACM59007
XANTHYLIUM,3,6-BIS(DIETHYLAMINO)-9-[2-(METHOXYCARBONYL)PHENYL]-,CYANO CUPRATE FERRATECOMPLEXES
CAS:102262-31-7
ACM102262317
XANTHYLIUM,3-[(2,6-DIMETHYLPHENYL)AMINO]-6-[(2,6-DIMETHYLSULFOPHENYL)AMINO]-9-(2-SULFOPHENYL)-,INNER SALT,SODIUM SALT(1:1)
CAS:12220-28-9
Formula: C35H30N2O7S2.Na
676.73373
ACM12220289
Xanthylium,3-[(2,6-dimethylphenyl)amino]-6-[(2,6-dimethylsulfophenyl)amino]-9-(2-sulfophenyl)-,innersalt,monosodiumsalt;ACID RED 289;hydrogen 3-(2,6-dimethylanilino)-6-(2,6-dimethylsulphonatoanilino)-9-(2-sulphonatophenyl)xanthylium, monosodium salt;Xant
XANTPHOS PD G3
948.35
ACM-00013623
XANTPHOS PD G4
962.38
ACM-00013890
XANTPHOS-PD-G2
CAS:1375325-77-1
Formula: C51H42ClNOP2Pd;
888.721g/mol
ACM1375325771
1375325-77-1;Chloro[(4,5-bis(diphenylphosphino)-9,9-dimethyl xanthene)-2-(2-amino-1,1-biphenyl)]palladium(II);XantPhos-Pd-G2;
XCC
CAS:96865-83-7
Formula: C19H22N4O5
C19H22N4O5
ACM96865837
XENON DIFLUORIDE
CAS:13709-36-9
Formula: F2Xe
169.29
ACM13709369
XENON DIFLUORIDE;XENON(II)FLUORIDE;PGF2B;xenonfluoride(xef2);XENON DIFLUORIDE, 99.99%;XENON DIFLUORIDE 99%;Xenon(II)fluoride,99+%;Xenon difluoride 99.9%
XENON-132XE
CAS:14155-79-4
Formula: Xe
131.90
ACM14155794
Xenon-132Xe, 14155-79-4
XENYSALATE
CAS:3572-52-9
Formula: C19H23NO3
313.395
ACM3572529
Xenysalatum; Xenisalato; Biphenamine; Alvinine; Xenysalate;
XJ735
CAS:153381-95-4
Formula: C25H33F3N8O9
646.57
ACM153381954
XL-184
CAS:1021950-26-4
Formula: C31H31FN6O5
ACM1021950264
XPHOS PD G1
CAS:1028206-56-5
Formula: C41H59ClNPPd;
738.774g/mol
ACM1028206565
(2-Dicyclohexylphosphino-2 inverted exclamation marka,4 inverted exclamation marka,6 inverted exclamation marka-triisopropyl-1,1 inverted exclamation marka-biphenyl)[2-(2-aminoethyl)phenyl)]palladium(II) chloride; XPhos precatalyst; J-520016; Chloro(2-dic
XPHOS PD G2
CAS:1310584-14-5
Formula: C45H59ClNPPd
786.80
ACM1310584145
2nd Generation XPhos Precatalyst
XPHOS PD G2
CAS:1310584-14-5
Formula: C45H59ClNPPd
786.80
ACM1310584145
2nd Generation XPhos Precatalyst
XPHOS PD G3
CAS:1445085-55-1
Formula: C46H62NO3PPdS
846.45
ACM1445085551
XPhos-G3-Palladacycle
XPHOS PD G3
CAS:1445085-55-1
Formula: C46H62NO3PPdS
846.45
ACM1445085551
XPhos-G3-Palladacycle
XPHOS PD G4
860.47
ACM-00013494
XPHOS-PD-G2 GT CAPSULE
786.80
ACM-00013891
XYLAN
CAS:9014-63-5
Formula: C5H10O5
150.12
ACM9014635
XYLAZINE-D6
CAS:1228182-53-3
Formula: C12H16N2S
226.37
ACM1228182533
Xylazine-d6, 2-(2,6-Dimethyl-d6-phenylamino)-5,6-dihydro-4H-thiazine, 1228182-53-3
XYLENE CYANOL FF
CAS:4463-44-9
Formula: C25H27N2NaO7S2
554.61
ACM4463449
5-cyclohexadien-1-ylidene]methyl]-6-hydroxy--methyl-monosodiumsalt;CI 42135;CI 43535;LABOTEST-BB LT00847673;XYLENE CYANOL;XYLENE CYANOL FF;sodium hydrogen 4-[[4-(ethylamino)-m-tolyl][4-(ethylimino)-3-methylcyclohexa-2,5-dien-1-ylidene]methyl]-6-hydroxyben
XYLENE CYANOL FF
CAS:4463-44-9
Formula: C25H27N2NaO7S2
554.61
ACM4463449
5-cyclohexadien-1-ylidene]methyl]-6-hydroxy--methyl-monosodiumsalt;CI 42135;CI 43535;LABOTEST-BB LT00847673;XYLENE CYANOL;XYLENE CYANOL FF;sodium hydrogen 4-[[4-(ethylamino)-m-tolyl][4-(ethylimino)-3-methylcyclohexa-2,5-dien-1-ylidene]methyl]-6-hydroxyben
XYLENE SUBSTITUTE PURUM P.A.,FOR MICROSCOPY
Formula: C3H3BrO
ACM-00000568
XYLENOL ORANGE SODIUM SALT
CAS:63721-83-5
Formula: C31H31N2NaO13S
694.64
ACM63721835
XYLIDYL BLUE I SODIUM SALT
CAS:14936-97-1
Formula: C25H20N3NaO6S
513.5
ACM14936971
XYLOBIOSE
CAS:6860-47-5
Formula: C10H18O9
282.24
ACM6860475
1,4-D-XYLOBIOSE;XYLOBIOSE;D-Xylose, 4-O-.beta.-D-xylopyranosyl-;1,4-beta-Xylobiose;4-O--D-Xylopyranosyl--D-xylopyranose;4-O-(-D-Xylopyranosyl)-D-xylose;-1,4-Xylobiose;C01630
XYLOGLUCAN
CAS:37294-28-3
0
ACM37294283
Glucoxylan
XYLOOLIGOSACCHARIDE
CAS:87-99-0
Formula: C5H12O5
152.15
ACM87990
XYLOOLIGOSACCHARIDE
CAS:87-99-0
Formula: C5H12O5
152.15
ACM87990
XYLULOSE-5-PHOSPHATE
CAS:60802-29-1
Formula: C5H11O8P
0
ACM60802291
(2,3,5-trihydroxy-4-oxopentyl) dihydrogen phosphate;2-Pentulose 5-(dihydrogen phosphate)
XYLYL DIBUTYLBENZOFURANONE
CAS:181314-48-7
Formula: C24H30O2
350.49
ACM181314487
HP-136;XYLYL DIBUTYLBENZOFURANONE;2(3H)-Benzofuranone, 5,7-bis(1,1-dimethylethyl)-3-hydroxy-, reaction products with o-xylene;Reaction product of 5,7-bis(1,1-dimetylethyl)-3-hydroxy-2(3H)-benzofuranone with o-xylene;3,4-Dibutyl-5-(2,4-dimethylphenyl)benzo
Y 134
CAS:849662-80-2
Formula: C28H28N2O3S
0
ACM849662802-1
[6-HYDROXY-2-(4-HYDROXYPHENYL)BENZO[B]THIEN-3-YL]-[4-[4-(1-METHYLETHYL)-1-PIPERAZINYL]PHENYL]METHANONE;Y 134
Y-29794 OXALATE
CAS:129184-48-1
Formula: C25H36N2O5S2
508.69
ACM129184481
Y-ZEOLITE
CAS:12173-28-3
ACM12173283-10
YAM EXTRACT
ACM-00003471
extractive form Chinese yam
YATEIN
CAS:40456-50-6
Formula: C22H24O7
400.42
ACM40456506
Dihydroanhydropodorhizol; deoxypodorhizone; Yatein;
YEAST
CAS:8013-01-2
ACM8013012
YELLOW INHIBITOR HN-150
CAS:85095-61-0
Formula: C19H26N6O2
370.45
ACM85095610
Yellow inhibitor HN-150;hydrazinecarboxamide,n,n'-(methylenedi-4,1-phenylene)bis[2,2-dimethyl-;1,1,1,1-TETRAMETHYL-4,4-(METHYLENEDI-P-PHENYLENE)DISEMICARBAZIDE;BIS[4-[3-(DIMETHYLAMINO)UREIDO]PHENYL]METHANE;1,1,1,1-Tetramethyl[4,4-methylenebis(4,1-phenylen
YELLOW IRON OXIDE
CAS:1309-33-7
Formula: FeH3O3
106.86702
ACM1309337
YIL 781
CAS:875258-85-8
Formula: C24H28FN3O2.HCl
C24H28FN3O2.HCl
ACM875258858
YIL 781, 875258-85-8, yil-781, MolPort-023-277-008, AKOS024457897, KB-276128, S-7802, 6-(4-Fluorophenoxy)-2-methyl-3-[[(3S)-1-(1-methylethyl)-3-piperidinyl]methyl]-4(3H)-quinazolinone
YK11
CAS:1370003-76-1
Formula: C25H34O6
0
ACM1370003761
YK-11-OA;(17alpha,20E)-17,20-[(1-Methoxyethylidene)bis(oxy)]-3-oxo-19-norpregna-4,20-diene-21-carboxylic acid methyl ester
YM 230888
CAS:446257-23-4
Formula: C19H28N4OS
C19H28N4OS
ACM446257234
MolPort-023-276-623, AKOS024457368, YM 230888, 4-(Cycloheptylamino)-N-[[(2R)-tetrahydro-2-furanyl]methyl]-thieno[2,3-d]pyrimidine-6-methanamine, 446257-23-4
YM 750
CAS:138046-43-2
Formula: C31H36N2O
C31H36N2O
ACM138046432
SureCN4106190, CTK8E7371, YM 750, 138046-43-2
YOHIMBINE EXTRACT
CAS:65-19-0
Formula: C21H26N2O3HCl
390.91
ACM65190
yohimbine extractive
YOHIMBINE EXTRACT
CAS:65-19-0
Formula: C21H26N2O3HCl
390.91
ACM65190
yohimbine extractive
YOHIMBINIC ACID MONOHYDRATE
CAS:522-87-2
Formula: C20H26N2O4
358.43
ACM522872
YOHIMBINIC ACID MONOHYDRATE;YOHIMBIC ACID;YOHIMBIC ACID HYDRATE;Yohimbic;YOHIMBIC ACID(RG);YOHIMBIC ACID MONOHYDRATE;yohimbine acid;yohimbinic acid
YTTERBIUM
CAS:7440-64-4
Formula: Yb;
173.054g/mol
ACM7440644-1
Yb; Ytterbium, wire reel, 50mm, diameter 1.0mm, square section, 99.9%; Ytterbium, wire reel, 200mm, diameter 1.0mm, square section, 99.9%; Ytterbium, plasma standard solution, Specpure(R), Yb 10,000microg/ml; Ytterbium, lump, 50g, max. size 25mm, 99.9%; Y
YTTERBIUM ATOMIC ABSORPTION STANDARD SOLUTION
ACM-00013781
YTTERBIUM BROMIDE HYDRATE
CAS:15163-03-8
Formula: Br3H2OYb
430.77
ACM15163038
YTTERBIUM BROMIDE HYDRATE;YTTERBIUM(III)BROMIDE HYDRATE;YTTERBIUM BROMIDE HYDRATE, 99.999%;Ytterbium(III)bromide hydrate, 99.99%;Ytterbium(III)bromidehydrate(99.9%-Yb)(REO);Ytterbium(III) bromide hydrate, REacton(R), 99.99% (REO);Ytterbium(III) bromide di
YTTERBIUM BROMIDE HYDRATE
CAS:15163-03-8
Formula: Br3H2OYb
430.77
ACM15163038
YTTERBIUM BROMIDE HYDRATE;YTTERBIUM(III)BROMIDE HYDRATE;YTTERBIUM BROMIDE HYDRATE, 99.999%;Ytterbium(III)bromide hydrate, 99.99%;Ytterbium(III)bromidehydrate(99.9%-Yb)(REO);Ytterbium(III) bromide hydrate, REacton(R), 99.99% (REO);Ytterbium(III) bromide di
YTTERBIUM CHLORIDE, ANHYDROUS
CAS:10261-91-8
ACM10261918
YTTERBIUM IODIDE
CAS:13813-44-0
Formula: H2I3OYb
571.77
ACM13813440
YTTERBIUM IODIDE;ytterbium triiodide;YTTERBIUM(II) IODIDE, POWDER,;Ytterbiumiodidepowder;Ytterbiumiodidepowder99.9+%;ytterbium(ii) iodide;EINECS 237-474-5;Ytterbium(III) iodide
YTTERBIUM NANOFOIL
CAS:7440-64-4
Formula: Yb
173.04
ACM7440644
YTTERBIUM SILICIDE
CAS:12039-89-3
Formula: Si2Yb
ACM12039893
YTTERBIUM SILICIDE;ytterbium disilicide;99.9%(metalsbasis,excludingTa),Ta0.4%;Ytterbium silicide, 99.9% (metals basis, excluding Ta), Ta 0.4%
YTTERBIUM(II) IODIDE
CAS:19357-86-9
Formula: YbI2
426.85
ACM19357869
Ytterbium(II) iodide, Diiodoytterbium, AC1N5ZU6, 494372_ALDRICH, 19357-86-9
YTTERBIUM(III) ACETATE HYDRATE
Formula: Yb(C2H3O2)3 xH2O
350.17 (anhydrous basis)
ACM-00013782
YTTERBIUM(III) ACETATE TETRAHYDRATE
CAS:15280-58-7
Formula: C6H20O10Yb;
425.27g/mol
ACM15280587
KS-00000ETU; ytterbium(iii)acetate hydrate; 7722AF; C6H9O6Yb.4H2O; K-4840; 15280-58-7; Ytterbium(III) acetate hydrate;
YTTERBIUM(III) BENZENESULFONATE, FUNCTIONALIZED SILICA GEL
ACM-00013783
YTTERBIUM(III) CHLORIDE
CAS:10361-91-8
Formula: YbCl3
279.40
ACM10361918
YTTERBIUM CHLORIDE, ANHYDROUS, 99.9%, 10361-91-8
YTTERBIUM(III) CHLORIDE
CAS:10361-91-8
Formula: YbCl3
279.40
ACM10361918
YTTERBIUM CHLORIDE, ANHYDROUS, 99.9%, 10361-91-8
YTTERBIUM(III) CHLORIDE HEXAHYDRATE
CAS:10035-01-5
Formula: YbCl3 6H2O
387.49
ACM10035015
YTTERBIUM(+3)CHLORIDE HEXAHYDRATE;YTTERBIUM(III) CHLORIDE HEXAHYDRATE;YTTERBIUM (III) CHLORIDE;YTTERBIUM CHLORIDE HEXAHYDRATE;Ytterbium(III) chloride hexahydrate, 99.9% metals basis;Ytterbium(III) chloride hexahydrate, 99.998% metals basis;YTTERBIUM(III)
YTTERBIUM(III) CHLORIDE HEXAHYDRATE
CAS:10035-01-5
Formula: YbCl3 6H2O
387.49
ACM10035015
YTTERBIUM(+3)CHLORIDE HEXAHYDRATE;YTTERBIUM(III) CHLORIDE HEXAHYDRATE;YTTERBIUM (III) CHLORIDE;YTTERBIUM CHLORIDE HEXAHYDRATE;Ytterbium(III) chloride hexahydrate, 99.9% metals basis;Ytterbium(III) chloride hexahydrate, 99.998% metals basis;YTTERBIUM(III)
YTTERBIUM(III) FLUORIDE
CAS:13760-80-0
Formula: YbF3;F3Yb;
230.049g/mol
ACM13760800
SY011812; CTK3J1933; ANW-20342; ytterbium(3+) trifluoride; ACMC-209ceg; RT-005125; AKOS015833206; LS60260; Ytterbium(III);
YTTERBIUM(III) ISOPROPOXIDE
CAS:6742-69-4
Formula: C9H21O3Yb;
350.318g/mol
ACM6742694
CTK8C5323; YTTERBIUM ISOPROPOXIDE; AKOS025295618; Triisopropoxyytterbium; Ytterbium(III) isopropoxide; Ytterbium i-propoxide;
YTTERBIUM(III) OXIDE
CAS:1314-37-0
Formula: Yb2O3
394.08
ACM1314370
Ytterbium monoxide
YTTERBIUM(III) OXIDE
CAS:1314-37-0
Formula: Yb2O3
394.08
ACM1314370
Ytterbium monoxide
YTTERBIUM(III) POLYSTYRENESULFONATE
ACM-00013784
YTTERBIUM(III) TRIFLUOROMETHANESULFONATE
CAS:54761-04-5
Formula: C3F9O9S3Yb;
620.244g/mol
ACM54761045
Ytterbium(III) triflate, 99.9%, (trace metal basis), anhydrous; ytterbium (III) triflate; Ytterbium (III) trifluoromethane-sulfonate; tris(fluoranyl)methanesulfonate; TR-019362; ytterbium(iii)trifluoromethanesulfonate; ytterbium(3+); KS-00000ET4; A830357;
YTTERBIUM(III) TRIFLUOROMETHANESULFONATE HYDRATE
CAS:252976-51-5
Formula: C3H5F9O10S3Yb;
641.283g/mol
ACM252976515
YTTERBIUM(III) TRIFLUOROMETHANESULFONATE N-HYDRATE; YTTERBIUM TRIFLATE HYDRATE; SC11043; 252976-51-5; YB(OTF)3 HYDRATE; Ytterbium(III) trifluoromethanesulfonate hydrate; YTTERBIUM(III) TRIFLATE HYDRATE, 99.90%; Ytterbium(III) trifluoromethanesulphonate hy
YTTERBIUM(III)IONOPHORE I
CAS:125110-14-7
Formula: C16H15N5O7S23H2O
507.5
ACM125110147
Cefixime trihydrate, Oraken, Cefixime hydrate, 125110-14-7, UNII-97I1C92E55, (6R,7R)-7-(((2Z)-2-(2-Amino-1,3-thiazol-4-yl)-2-(carboxymethyloxyimino)acetyl)amino)-3-ethenyl-8-oxo-5-thia-1-azabicyclo(4.2.0)oct-2-ene-2-carboxylic acid trihydrate
YTTERBIUM(III)IONOPHORE II
CAS:80648-84-6
Formula: C18H14N2O3
306.315360 [g/mol]
ACM80648846
Ytterbium(III) Ionophore II, 80648-84-6, 3-Hydroxy-2-naphthoic(2-hydroxybenzylidene)hydrazide, 3-Hydroxy-N inverted exclamation marka-[(2-hydroxyphenyl)methylene]-2-naphthydrazide
YTTRIA STABILIZED ZIRCONIA NANOPARTICLE DISPERSION
Formula: Y2O3 ZrO2
ACM-00000355
YSZ Nanopowder, Yttrium stabilized zirconium nanopowder, yttria stabilized zirconia nanoparticles, Yttria Stabilized Zirconia nanopowder suspension, aqueous Yttria Stabilized Zirconia nanoparticle solution, Yttria Stabilized Zirconia nanofluid
YTTRIA STABILIZED ZIRCONIA NANOPARTICLES / NANOPOWDER
Formula: Y2O3 ZrO2
ACM-00000343
YSZ Nanopowder
YTTRIUM
CAS:7440-65-5
Formula: Y;
88.906g/mol
ACM7440655-2
Yttrium, powder, 500 max. part. size (micron), weight 100 g, purity 99.9%; Yttrium, foil, not light tested, 50x50mm, thickness 0.025mm, as rolled, 99%; Yttrium, plasma standard solution, Specpure(R), Y 1000microg/ml; Yttrium, powder, max. particle size 50
YTTRIUM 2-ETHYLHEXANOATE
CAS:103470-68-4
Formula: C24H45O6Y
518.51635
ACM103470684
YTTRIUM ALUMINATE NANOPARTICLES / NANOPOWDER
CAS:12253-70-2
Formula: AlO3Y
163.89
ACM12253702
Yttrium aluminum oxide
YTTRIUM ALUMINUM OXIDE NANOPARTICLES
CAS:12005-21-9
Formula: Y3Al5O12
593.62
ACM12005219
Aluminum yttrium garnet
YTTRIUM ALUMINUM OXIDE NANOPARTICLES
CAS:12005-21-9
Formula: Y3Al5O12
593.62
ACM12005219
Aluminum yttrium garnet
YTTRIUM BARIUM COPPER OXIDE
CAS:107539-20-8
Formula: BaCuO5Y2
458.68
ACM107539208
SUPER TC(R)-123;YTTRIUM BARIUM COPPER OXIDE;YTTRIUM BARIUM COPPER OXIDE (2-1-1);YTTRIUM BARIUM COPPER OXIDE, 2 MICRON PO WDER, 99.9%;(1-2-4)99.9(metalsbasis);SUPER Tc123;barrier copper yttrium oxide;Mischoxid (Ba: 2/Cu: 3/O: x/Y: 1)
YTTRIUM CARBONATE
CAS:38245-39-5
Formula: C3O9Y2
357.84
ACM38245395
YTTERBIUM(III) CARBONATE N-HYDRATE;YTTRIUM CARBONATE HYDRATE;YTTRIUM CARBONATE;YTTRIUM (III) CARBONATE;YTTRIUM(III) CARBONATE HYDRATE;YTTRIUM CARBONATE HYDRATE, 99.9%;YTTRIUM(III) CARBONATE HYDRATE, 99.999% (REO);YTTRIUM(III) CARBONATE HYDRATE, 99.9% (REO
YTTRIUM CARBONATE
CAS:38245-39-5
Formula: C3O9Y2
357.84
ACM38245395
YTTERBIUM(III) CARBONATE N-HYDRATE;YTTRIUM CARBONATE HYDRATE;YTTRIUM CARBONATE;YTTRIUM (III) CARBONATE;YTTRIUM(III) CARBONATE HYDRATE;YTTRIUM CARBONATE HYDRATE, 99.9%;YTTRIUM(III) CARBONATE HYDRATE, 99.999% (REO);YTTRIUM(III) CARBONATE HYDRATE, 99.9% (REO
YTTRIUM CHLORIDE HEXAHYDRATE
CAS:10025-94-2
Formula: Cl3H12O6Y
303.36
ACM10025942
YTTRIUM(+3)CHLORIDE HEXAHYDRATE;YTTRIUM CHLORIDE 6H2O;YTTRIUM CHLORIDE HEXAHYDRATE;YTTRIUM CHLORIDE, HYDROUS;YTTRIUM CHLORIDE;YTTRIUM(III) CHLORIDE;YTTRIUM(III) CHLORIDE HEXAHYDRATE;YTTRIUM (III) CHLORIDE, HYDRATED
YTTRIUM EUROPIUM OXIDE NANOPARTICLES
CAS:68585-82-0
Formula: EuY2O3
230.85
ACM68585820-1
Yttrium oxide
YTTRIUM EUROPIUM OXIDE NANOPARTICLES
CAS:68585-82-0
Formula: EuY2O3
230.85
ACM68585820-1
Yttrium oxide
YTTRIUM FLUORIDE
CAS:13709-49-4
Formula: F3Y
145.9
ACM13709494
YTTRIUM FLUORIDE;YTTRIUM(III) FLUORIDE;yttriumfluoride(yf3);yttriumtrifluoride;Yttrium fluoride 99;YTTRIUM(III) FLUORIDE99.9%;YTTRIUM FLUORIDE, ANHYDROUS, POWDER, 99. 99%;YTTRIUM (III) FLUORIDE, ANHYDROUS, 99.9% (METALS BASIS)
YTTRIUM FLUORIDE
CAS:13709-49-4
Formula: F3Y
145.9
ACM13709494
YTTRIUM FLUORIDE;YTTRIUM(III) FLUORIDE;yttriumfluoride(yf3);yttriumtrifluoride;Yttrium fluoride 99;YTTRIUM(III) FLUORIDE99.9%;YTTRIUM FLUORIDE, ANHYDROUS, POWDER, 99. 99%;YTTRIUM (III) FLUORIDE, ANHYDROUS, 99.9% (METALS BASIS)
YTTRIUM IRON OXIDE NANOPARTICLES / NANOPOWDER
CAS:12063-56-8
Formula: Y3Fe5O12
737.94
ACM12063568
Yttrium iron oxide
YTTRIUM IRON OXIDE NANOPARTICLES / NANOPOWDER
CAS:12063-56-8
Formula: Y3Fe5O12
737.94
ACM12063568
Yttrium iron oxide
YTTRIUM ISOPROPOXIDE OXIDE
CAS:118458-20-1
Formula: OY5(OCH(CH3)2)13
1228.66
ACM118458201
YTTRIUM ISOPROPOXIDE OXIDE;TRIDECAKIS(ISOPROPANOLATO)(OXO)PENTAYTTRIUM;yttrium oxide isopropoxide;Yttrium (III) i-propoxide oxide;Tridecaisopropanolatooxopentayttrium
YTTRIUM ISOPROPOXIDE OXIDE
CAS:118458-20-1
Formula: OY5(OCH(CH3)2)13
1228.66
ACM118458201
YTTRIUM ISOPROPOXIDE OXIDE;TRIDECAKIS(ISOPROPANOLATO)(OXO)PENTAYTTRIUM;yttrium oxide isopropoxide;Yttrium (III) i-propoxide oxide;Tridecaisopropanolatooxopentayttrium
YTTRIUM NANOFOIL
CAS:7440-65-5
Formula: Y
88.91
ACM7440655-4
YTTRIUM NANOPARTICLE DISPERSION
CAS:7440-65-5
Formula: Y
88.91
ACM7440655
Yttrium nanopowder suspension, aqueous Yttrium nanoparticle solution, Yttrium nanofluid
YTTRIUM NANOPRISMS
CAS:7440-65-5
Formula: Y
88.91
ACM7440655-1
YTTRIUM NANORODS
CAS:7440-65-5
Formula: Y
88.91
ACM7440655-3
YTTRIUM NITRATE TETRAHYDRATE
CAS:13773-69-8
Formula: H8N3O13Y
346.98
ACM13773698
YTTRIUM NITRATE TETRAHYDRATE;YTTRIUM NITRATE TETRAHYDRATE, 99.999%;YTTRIUM NITRATE TETRAHYDRATE, 99.99%;Ytterbium nitrate tetrahydrate;yttrium(iii) nitrate tetrahydrate;YttriuM(III) nitrate tetrahydrate 99.99% trace Metals basis
YTTRIUM NITRIDE (YN)
CAS:25764-13-0
Formula: NY
102.91
ACM25764130
YTTRIUM NITRIDE;YTTRIUM NITRIDE 99.9%;Yttrium (III) nitride, 99.8% (metals basis);Monoyttrium mononitride;Nitriloyttrium
YTTRIUM OXIDE
CAS:11130-29-3
ACM11130293
YTTRIUMOXIDENANOPARTICLES
YTTRIUM OXIDE NANOPARTICLES / NANOPOWDER
CAS:1314-36-9
Formula: Y2O3
225.81
ACM1314369
Yttrium sesquioxide
YTTRIUM OXIDE NANOPARTICLES / NANOPOWDER
CAS:1314-36-9
Formula: Y2O3
225.81
ACM1314369
Yttrium sesquioxide
YTTRIUM OXIDE SILICATE (Y2O(SIO4)), CERIUM-DOPED
CAS:100403-12-1
Formula: O12Si3Y4
631.8727
ACM100403121
Yttrium oxide silicate (Y2O(SiO4)), cerium-doped;Einecs 309-553-5
YTTRIUM PERCHLORATE
CAS:14017-56-2
Formula: Cl3H12O18Y
495.35
ACM14017562
YTTRIUM(III) PERCHLORATE;YTTRIUM PERCHLORATE;YTTRIUM PERCHLORATE 6H2O;YTTRIUM PERCHLORATE HEXAHYDRATE;YTTRIUM PERCHLORATE HYDRATE;YTTRIUM PERCHLORATE, HYDRATED;Yttrium perchlorate solution;yttrium(3+) perchlorate
YTTRIUM PERCHLORATE
CAS:14017-56-2
Formula: Cl3H12O18Y
495.35
ACM14017562
YTTRIUM(III) PERCHLORATE;YTTRIUM PERCHLORATE;YTTRIUM PERCHLORATE 6H2O;YTTRIUM PERCHLORATE HEXAHYDRATE;YTTRIUM PERCHLORATE HYDRATE;YTTRIUM PERCHLORATE, HYDRATED;Yttrium perchlorate solution;yttrium(3+) perchlorate
YTTRIUM SULFATE OCTAHYDRATE
CAS:7446-33-5
Formula: H16O20S3Y2
610.12
ACM7446335
YTTRIUM SULFATE;YTTRIUM SULFATE OCTAHYDRATE;YTTRIUM(III) SULFATE;YTTRIUM(III)SULFATE OCTAHYDRATE;YTTRIUM SULFATE OCTAHYDRATE, 99.9%;YTTRIUM(III) SULFATE OCTAHYDRATE99.99&;YTTRIUM (III) SULFATE OCTAHYDRATE (99.9%-Y) (REO);YTTRIUM (III) SULFATE, REACTON, 99
YTTRIUM SULFATE OCTAHYDRATE
CAS:7446-33-5
Formula: H16O20S3Y2
610.12
ACM7446335
YTTRIUM SULFATE;YTTRIUM SULFATE OCTAHYDRATE;YTTRIUM(III) SULFATE;YTTRIUM(III)SULFATE OCTAHYDRATE;YTTRIUM SULFATE OCTAHYDRATE, 99.9%;YTTRIUM(III) SULFATE OCTAHYDRATE99.99&;YTTRIUM (III) SULFATE OCTAHYDRATE (99.9%-Y) (REO);YTTRIUM (III) SULFATE, REACTON, 99
YTTRIUM TRIFLUOROACETATE
CAS:304851-95-4
Formula: C6F9O6Y;
427.951g/mol
ACM304851954
Tri(trifluoroacetic acid) yttrium salt; Yttrium trifluoroacetate anhydrous; ACMC-1AETC; Yttrium(III) 2,2,2-trifluoroacetate; J-017981;
YTTRIUM(3+) TRIHYDROXIDE
CAS:1311-34-8
Formula: H3O3Y
139.928 g/mol
ACM1311348
Yttrium trihydroxide, Yttrium hydroxide, yttrium(3+) trihydroxide, AC1L39GX, Yttrium hydroxide (Y(OH)3), CTK0F6510, EINECS 240-520-7, AR-1L8273, AG-E-14440, 12688-14-1, 1311-34-8
YTTRIUM(3+)ORTHOBORATE
CAS:14060-30-1
Formula: BO3Y
147.71505
ACM14060301
yttrium(3+) orthoborate;Boric acid yttrium salt;Yttrium borate;Yttrium orthoborate
YTTRIUM(III) 2-ETHYLHEXANOATE
CAS:114012-65-6
Formula: C24H45O6Y;
518.524g/mol
ACM114012656
103470-68-4; YTTRIUM(III) 2-ETHYLHEXANOATE, 10% W/V IN N-HEXANE; Hexanoic acid,2-ethyl-, yttrium(3+) salt (3:1); Yttrium(III) 2-ethylhexanoate; yttrium tri(2-ethylhexanoate); DTXSID10575673; Yttrium(III) 2-ethylhexanoate (15-17% Y); 2-Ethylhexanoic acid y
YTTRIUM(III) ACETATE HYDRATE
CAS:304675-69-2
Formula: C6H11O7Y;
284.053g/mol
ACM304675692
304675-69-2;Acetic acid,yttrium(3+) salt, monohydrate (9CI);CTK4G5253;Yttrium(iii)acetate hydrate99.9%;KS-000018QX;AKOS025295099;RT-024488;
YTTRIUM(III) ACETYLACETONATE HYDRATE
CAS:207801-29-4
Formula: C15H24O6Y;
389.257g/mol
ACM207801294
15554-47-9;Yttrium(III) 2,4-pentanedionate hydrate;Yttrium acetylacetonate,;207801-29-4;MFCD00150172;MFCD00216639;Yttrium(III) acetylacetonate hydrate (99.9%-Y) (REO);
YTTRIUM(III) BUTOXIDE SOLUTION
CAS:111941-71-0
Formula: C12H30O3Y;
311.275g/mol
ACM111941710
YTTRIUM(III) CHLORIDE
CAS:10361-92-9
Formula: YCl3
195.26
ACM10361929
YTTRIUM (III) CHLORIDE;YTTRIUM CHLORIDE;yttriumchloride(ycl3);Yttriumchlorideanhydrous;Yttrium (III) chloride, anhydrous;YTTRIUM CHLORIDE, ANHYDROUS, POWDER, 99. 99%;Yttrium chloride 0.1 M Solution;Yttrium(III) chloride, anhydrous, beads, #10 mesh, 99.99%
YTTRIUM(III) CHLORIDE
CAS:10361-92-9
Formula: YCl3
195.26
ACM10361929
YTTRIUM (III) CHLORIDE;YTTRIUM CHLORIDE;yttriumchloride(ycl3);Yttriumchlorideanhydrous;Yttrium (III) chloride, anhydrous;YTTRIUM CHLORIDE, ANHYDROUS, POWDER, 99. 99%;Yttrium chloride 0.1 M Solution;Yttrium(III) chloride, anhydrous, beads, #10 mesh, 99.99%
YTTRIUM(III) CHLORIDE HYDRATE
CAS:12741-05-8
Formula: YCl3?xH2O
195.26(anhy)
ACM12741058
Yttrium(Iii) Chloride Hydrate, 12741-05-8, ACMC-1BQ0G, KSC171O8F, CTK0H1782, AG-D-57155, Yttrium(III) chloride hydrate;yttrium(iii) chloride hydrate, reacton;Yttrium(III) chloride hydrate, REacton(R), 99.9% (REO);Yttrium(III) chloride hydrate, REacton(R),
YTTRIUM(III) HEXAFLUOROACETYLACETONATE DIHYDRATE
CAS:33751-70-1
Formula: C15H10F18O8Y;
749.114g/mol
ACM33751701
Yttrium(III) hexafluoroacetylacetonate dihydrate;33751-70-1;
YTTRIUM(III) IODIDE
CAS:13470-38-7
Formula: I3Y;
469.619g/mol
ACM13470387
Yttrium(III) iodide;13470-38-7;ACMC-20aj93;CTK3J1902;AKOS025294354;RT-005104;
YTTRIUM(III) TRIFLUOROMETHANESULFONATE
CAS:52093-30-8
Formula: C3F9O9S3Y;
536.095g/mol
ACM52093308
J-525167; yttrium(3+) tritriflate; Yttrium triflate; DTXSID20370050; 52093-30-8; yttrium(3+) ion tritrifluoromethanesulfonate; SC10887; KS-00000ET1; Yttrium(III) trifluoromethanesulfonate; yttrium(III) triflate;
YTTRIUM(III) TRIS(2,2,6,6-TETRAMETHYL-3,5-HEPTANEDIONATE)
CAS:15632-39-0
Formula: Y(OCC(CH3)3CHCOC(CH3)3)3
638.71
ACM15632390
TRIS(2,2,6,6-TETRAMETHYL-3,5-HEPTANEDIONATO)YTTRIUM;TRIS(2,2,6,6-TETRAMETHYL-3,5-HEPTANEDIONATO)YTTRIUM(III);YTTRIUM TRIS(2,2,6,6-TETRAMETHYL-3,5-HEPTANEDIONATE);YTTRIUM TRIS (DIPIVALOYLMETHANATE);YTTRIUM(III) TRIS(2,2,6,6-TETRAMETHYL-3,5-HEPTANEDIONATE);
YTTRIUM(III) TRIS(ISOPROPOXIDE)
CAS:2172-12-5
Formula: C9H21O3Y;
266.17g/mol
ACM2172125
Triisopropoxyyttrium; TC-164617; 2172-12-5; yttrium (III) isopropoxide; DTXSID40468443;
YTTRIUM(III)BROMIDE HYDRATE
CAS:13759-89-2
Formula: Br3Yb
412.75
ACM13759892
YTTRIUM(III) BROMIDE HYDRATE;YTTRIUM BROMIDE HYDRATE;YTTERBIUM (III) BROMIDE;YTTERBIUM BROMDIE;YTTERBIUM BROMIDE;YbBr3;Ytterbium bromide (YbBr3);ytterbiumbromide(ybbr3)
YTTRIUM(III)PHOSPHATE
CAS:13990-54-0
Formula: O4PY
183.88
ACM13990540
YTTRIUM PHOSPHATE;YTTRIUM (III) PHOSPHATE;YTTRIUM(III) PHOSPHATE, 99.99+%;Yttrium(III)phosphate,99.99%(REO);YTTRIUM PHOSPHATE, 99.99%;Phosphoric acid yttrium salt;Yttrium orthophosphate;Phosphoric acid,yttrium(3+) salt (1:1)
YTTRIUM-NICKELALLOY,YNI5
CAS:12333-67-4
Formula: YNi5
ACM12333674
Yttrium-Nickelalloy,YNi5
YU BORYLATION LIGAND
CAS:40335-00-0
Formula: C11H11NO2;
189.214g/mol
ACM40335000
AC1L3L4C; NSC298324; CTK4I2891; 40335-00-0; AK199077; DTXSID70193337; AKOS026674211; quinoline, 2,4-dimethoxy-; CS-0012593;
YU FLUORINATION LIGAND
241.33
ACM-00013851
YU-WASA AUXILIARY
CAS:651-83-2
Formula: C7H2F7N;
233.089g/mol
ACM651832
4-Aminoheptafluorotoluene; SBB030245; 4-aminotetrafluorobenzotrifluoride; ANW-42843; TR-022211; SCHEMBL1639619; 2,3,5,6-tetrafluoro-4-trifluoromethyl-phenylamine; AC1LDCVP; FT-0617615; 2,3,5,6,alpha,alpha,alpha-Heptafluoro-p-toluidine;
Z)-FENPYROXIMATE
CAS:149054-53-5
ACM149054535
Z-(1)-ETHOXY-(2)-(TRIBUTYLSTANNYL)ETHYLEN
CAS:64724-29-4
Formula: C16H34OSn
361.15056
ACM64724294
MolPort-003-844-341, MolPort-006-717-155, CID5706773, Tributyl-[(E)-2-ethoxyethenyl]stannane, (Z)-1-Ethoxy-2-(tributylstannyl)ethene, TC-068802, 64724-29-4
Z-1,2-TRANS-ACHC-OH
CAS:61935-48-6
Formula: C15H19NO4
277.32
ACM61935486
Z-1,4-CIS-ACHC-OH
CAS:67299-52-9
Formula: C15H19NO4
277.32
ACM67299529
Oprea1_754808, MLS000038274, MLS000551309, STOCK1S-02315, STOCK1S-65363, MolPort-000-801-372, MolPort-002-551-753, MolPort-004-748-545, CID285247, NSC142050, SMR000038295, SMR000145235, C2036, 4-Benzyloxycarbonylamino-cyclohexanecarboxylic acid, trans-4-(
Z-1-CHLORO-3,3,3-TRIFLUOROPROPENE-1
CAS:99728-16-2
0
ACM99728162
Z-1-Chloro-3,3,3-trifluoropropene-1
Z-10-PENTADECEN-1-OL
Formula: C15H30O
226.4
ACM-00017865
Z-10-TETRADECENYL ACETATE
CAS:35153-16-3
Formula: C16H30O2
254.41
ACM35153163
10Z-14Ac
Z-10-TETRADECENYL ACETATE
CAS:35153-16-3
Formula: C16H30O2
254.41
ACM35153163
10Z-14Ac
Z-11-HEXADECEN-1-OL
CAS:56683-54-6
Formula: C16H32O
240.42
ACM56683546
11Z-16OH
Z-11-HEXADECEN-1-OL
CAS:56683-54-6
Formula: C16H32O
240.42
ACM56683546
11Z-16OH
Z-11-HEXADECENAL
CAS:53939-28-9
Formula: C16H30O
238.41
ACM53939289
11Z-16CHO
Z-11-HEXADECENAL
CAS:53939-28-9
Formula: C16H30O
238.41
ACM53939289
11Z-16CHO
Z-11-HEXADECENYL ACETATE
CAS:34010-21-4
Formula: C18H34O2
282.46
ACM34010214
11Z-16Ac
Z-11-HEXADECENYL ACETATE
CAS:34010-21-4
Formula: C18H34O2
282.46
ACM34010214
11Z-16Ac
Z-11-TETRADECEN-1-OL
CAS:34010-15-6
Formula: C14H28O
212.37
ACM34010156
11Z-14OH
Z-11-TETRADECEN-1-OL
CAS:34010-15-6
Formula: C14H28O
212.37
ACM34010156
11Z-14OH
Z-11-TETRADECENAL
CAS:35237-64-0
Formula: C14H26O
210.36
ACM35237640
11Z-14CHO
Z-11-TETRADECENAL
CAS:35237-64-0
Formula: C14H26O
210.36
ACM35237640
11Z-14CHO
Z-13-OCTADECANAL
CAS:58594-45-9
Formula: C18H34O
266.46
ACM58594459
13Z-18CHO
Z-13-OCTADECANAL
CAS:58594-45-9
Formula: C18H34O
266.46
ACM58594459
13Z-18CHO
Z-13-OCTADECENYL ACETATE
CAS:60037-58-3
Formula: C20H38O2
310.51
ACM60037583
13Z-18Ac
Z-13-OCTADECENYL ACETATE
CAS:60037-58-3
Formula: C20H38O2
310.51
ACM60037583
13Z-18Ac
Z-2-BROMO-4,4,4-TRIFLUORBUTENOIC ACID, ETHYL ESTER
CAS:136264-28-3
Formula: C6H6BrF3O2
247.01
ACM136264283
Z-2-Bromo-4,4,4-trifluorbutenoic acid, ethyl ester;Ethyl 2-bromo-4,4,4-trifluorobut-2-enoate;(Z)-2-Bromo-4,4,4-trifluorobutenoic acid ethyl ester
Z-2-BROMO-4,4,4-TRIFLUORBUTENOIC ACID, ETHYL ESTER
CAS:136264-28-3
Formula: C6H6BrF3O2
247.01
ACM136264283
Z-2-Bromo-4,4,4-trifluorbutenoic acid, ethyl ester;Ethyl 2-bromo-4,4,4-trifluorobut-2-enoate;(Z)-2-Bromo-4,4,4-trifluorobutenoic acid ethyl ester
Z-3-(2-NAPHTHYL)-L-ALANINE CHLOROMETHYLKETONE
CAS:128019-71-6
Formula: C22H20ClNO3
381.86
ACM128019716
Z-3-AMINOBENZOIC ACID N-HYDROXYSUCCINIMIDE ESTER
CAS:129666-48-4
Formula: C19H16N2O6
368.68
ACM129666484
129666-48-4, CTK8F0069, AK-57234, Z-3-aminobenzoic acid N-hydroxysuccinimide ester, 2,5-Dioxopyrrolidin-1-yl 3-(((benzyloxy)carbonyl)amino)benzoate
Z-4-AMINO-3-HYDROXYBUTYRIC ACID
CAS:118125-41-0
Formula: C12H15NO5
253.25
ACM118125410
SCHEMBL222634, FHBQZMZFAJJFDA-UHFFFAOYSA-N, MolPort-020-004-670, Z-4-AMINO-3-HYDROXYBUTYRIC ACID, 4-benzyloxycarbonylamino-3-hydroxy-butyric acid, K-1241, 118125-41-0
Z-5-DECENYL ACETATE
CAS:67446-07-5
Formula: C12H22O2
198.3
ACM67446075
5Z-10Ac
Z-5-DECENYL ACETATE
CAS:67446-07-5
Formula: C12H22O2
198.3
ACM67446075
5Z-10Ac
Z-5-DODECENYL ACETATE
CAS:16676-96-3
Formula: C14H26O2
226.36
ACM16676963
5Z-12Ac
Z-5-DODECENYL ACETATE
CAS:16676-96-3
Formula: C14H26O2
226.36
ACM16676963
5Z-12Ac
Z-5-TETRADECENYL ACETATE
CAS:35153-13-0
Formula: C16H30O2
254.41
ACM35153130
5Z-14Ac
Z-5-TETRADECENYL ACETATE
CAS:35153-13-0
Formula: C16H30O2
254.41
ACM35153130
5Z-14Ac
Z-6-PETROSELINYL ACETATE
Formula: C20H38O2
310.51
ACM-00017897
Z-7-DECENYL ACETATE
CAS:13857-03-9
Formula: C12H22O2
198.3
ACM13857039
7Z-10Ac
Z-7-DECENYL ACETATE
CAS:13857-03-9
Formula: C12H22O2
198.3
ACM13857039
7Z-10Ac
Z-7-DODECENYL ACETATE
CAS:14959-86-5
Formula: C14H26O2
226.36
ACM14959865
7Z-12Ac
Z-7-DODECENYL ACETATE
CAS:14959-86-5
Formula: C14H26O2
226.36
ACM14959865
7Z-12Ac
Z-7-EICOSENE-11-ONE
CAS:63408-44-6
Formula: C20H38O
294.46
ACM63408446
7Z-20-11Kt
Z-7-EICOSENE-11-ONE
CAS:63408-44-6
Formula: C20H38O
294.46
ACM63408446
7Z-20-11Kt
Z-7-HEXADECENYL ACETATE
CAS:23192-42-9
Formula: C18H34O2
282.46
ACM23192429
7Z-16Ac
Z-7-HEXADECENYL ACETATE
CAS:23192-42-9
Formula: C18H34O2
282.46
ACM23192429
7Z-16Ac
Z-7-NONADECEN-11-ONE
CAS:63408-45-7
Formula: C19H36O
280.46
ACM63408457
7Z-19-11Kt
Z-7-NONADECEN-11-ONE
CAS:63408-45-7
Formula: C19H36O
280.46
ACM63408457
7Z-19-11Kt
Z-7-TETRADECEN-2-ONE
CAS:146955-45-5
Formula: C14H26O
210.36
ACM146955455
Z-7-TETRADECEN-2-ONE
CAS:146955-45-5
Formula: C14H26O
210.36
ACM146955455
Z-7-TETRADECENYL ACETATE
CAS:16974-10-0
Formula: C16H30O2
254.41
ACM16974100
7Z-14Ac
Z-7-TETRADECENYL ACETATE
CAS:16974-10-0
Formula: C16H30O2
254.41
ACM16974100
7Z-14Ac
Z-8-DODECEN-1-OL
CAS:40642-40-8
Formula: C12H24O
184.32
ACM40642408
8Z-12OH
Z-8-DODECEN-1-OL
CAS:40642-40-8
Formula: C12H24O
184.32
ACM40642408
8Z-12OH
Z-9-DODECEN-1-OL
CAS:35148-18-6
Formula: C12H24O
184.32
ACM35148186
9Z-12OH
Z-9-DODECEN-1-OL
CAS:35148-18-6
Formula: C12H24O
184.32
ACM35148186
9Z-12OH
Z-9-DODECEN-1-OL
CAS:143-28-2
Formula: C18H36O
268.48
ACM143282
OLEYL ALCOHOL
Z-9-HEXADECENAL
CAS:56219-04-6
Formula: C16H30O
238.41
ACM56219046
9Z-16CHO
Z-9-HEXADECENAL
CAS:56219-04-6
Formula: C16H30O
238.41
ACM56219046
9Z-16CHO
Z-9-TETRADECENAL
CAS:53939-27-8
Formula: C14H26O
210.36
ACM53939278
9Z-14CHO
Z-9-TETRADECENAL
CAS:53939-27-8
Formula: C14H26O
210.36
ACM53939278
9Z-14CHO
Z-907
CAS:502693-09-6
ACM502693096
Z-ABU-OSU
CAS:71447-81-9
Formula: C16H18N2O6
334.33
ACM71447819
Z-ALA-4M-BETANA
CAS:201982-94-7
Formula: C22H22N2O4
378.42
ACM201982947
CTK8E8773, Z-L-alanine 4-methoxy-beta-naphthylamide, 201982-94-7
Z-ALA-ALA-OH
CAS:16012-70-7
Formula: C14H18N2O5
294.3
ACM16012707
Z-ALA-GLN-OH
CAS:21467-17-4
Formula: C16H21N3O6
351.35
ACM21467174
Z-ALA-GLU-OH
CAS:102601-36-5
Formula: C16H20N2O7
352.34
ACM102601365
Z-ALA-LEU-OH
CAS:24959-68-0
Formula: C17H24N2O5
336.38
ACM24959680
Z-ALA-ONP
CAS:1168-87-2
Formula: C17H16N2O6
344.32
ACM1168872
Z-ALA-TRP-OH
CAS:119645-65-7
Formula: C22H23N3O5
409.44
ACM119645657
Z-ARG(BOC)2-OH CHA
CAS:145315-39-5
Formula: C24H36N4O8C6H13N
607.75
ACM145315395
145315-39-5, Z-ARG 2-OHCHA, Z-ARG(BOC)2-OH CHA, MolPort-020-003-806, QBGRVFFDXXNSRE-LMOVPXPDSA-N, K-4653, N2-[(benzyloxy)carbonyl]-N5-[[bis(tert-butoxycarbonyl)amino](imino)methyl]-L-ornithine cyclohexanamine
Z-ARG(Z)2-OSU
CAS:132160-73-7
Formula: C34H35N5O10
673.68
ACM132160737
1.3-Diamino-2-aminomethyl-propan; 2-Aminomethyl-propandiyldiamin; 2-aminomethyl-propanediyldiamine; 1,3-diamino-2-aminomethylpropane; 2-amino-methyl-1,3-diamino-propane;
Z-ASN-OME
CAS:4668-37-5
Formula: C13H16N2O5
280.28
ACM4668375
SureCN5181237, Z-L-asparagine methyl ester, CTK8G3854, AG-F-59954, 4668-37-5, Asparagine,N2-carboxy-, N-benzyl methyl ester, L- (8CI); N-Benzyloxycarbonylasparaginemethyl ester; N-Carbobenzoxy-L-asparagine methyl ester;N2-Benzyloxycarbonyl-L-asparagine me
Z-ASP(ONP)-OBZL
CAS:58238-28-1
Formula: C25H22N2O8
478.46
ACM58238281
Z-ASP(OSU)-OBZL
CAS:108325-86-6
Formula: C23H22N2O8
454.44
ACM108325866
Z-ASP(OTBU)-BROMOMETHYL KETONE
CAS:153088-76-7
Formula: C17H22BrNO5
400.26
ACM153088767
Z-ASP(OTBU)-OME
CAS:63327-57-1
Formula: C17H23NO6
337.37
ACM63327571
Z-ASP(OTBU)-ONP
CAS:17543-17-8
Formula: C22H24N2O8
444.43
ACM17543178
Z-ASP-2,6-DICHLOROBENZOYLOXYMETHYLKETONE
CAS:153088-73-4
Formula: C20H17Cl2NO7
454.26
ACM153088734
Z-ASU(OTBU)-OH DCHA
CAS:49645-27-4
Formula: C32H52N2O6
560.77
ACM49645274
Z-L-Ala-L-Val-OMe; Z-Ala-Val-OMe; Cbz-Ala-Val-OMe; (S)-2-(((benzyloxy)carbonyl)amino)-8-(tert-butoxy)-8-oxooctanoic acid; N-CBZ-L-Ala-Val Methyl ester; N-Carbobenzoxy-L-alanyl-L-valine Methyl Ester; Z-L-alanyl-L-valine methyl ester; Z-L-Asu(OtBu); (2S)-2-
Z-BETA-ALA-GLY-GLY-OH
CAS:102601-37-6
Formula: C15H19N3O6
337.33
ACM102601376
Z-BETA-ALA-GLY-GLY-OH;N-CBZ-B-ALA-GLY-GLY
Z-BETA-ALA-NH2
CAS:886-64-6
Formula: C11H14N2O3
222.24
ACM886646
NSC290815, CID324693, ZINC01565644, EN300-42666, 886-64-6
Z-CIS-1,2-AMINOCYCLOHEX-4-ENE CARBOXYLIC ACID
CAS:124753-65-7
Formula: C15H17NO4
275.3
ACM124753657
Z-D-ALA-NH2
CAS:151378-81-3
Formula: C11H14N2O3
222.24
ACM151378813
Z-D-ALA-NH2, 151378-81-3, AC1OCUTK, SCHEMBL2627373, CTZZSWNVVFTJRN-MRVPVSSYSA-N, MolPort-020-004-647, AJ-21744, AK170197, K-4808, benzyl [(1R)-2-amino-1-methyl-2-oxoethyl]carbamate, benzyl N-[(2R)-1-amino-1-oxopropan-2-yl]carbamate
Z-D-ARG(PMC)-OH CHA
CAS:200191-08-8
Formula: C28H38N4O7SC6H13N
673.87
ACM200191088
Z-D-ARG(Z)2-OSU
CAS:200191-86-2
Formula: C34H35N5O10
673.68
ACM200191862
Z-D-ARG-GLY-ARG-PNA . 2 HCL
CAS:113711-77-6
Formula: C28H39N11O7.2HCl
714.6
ACM113711776
Z-D-ARG-GLY-ARG-PNA 2 HCL
Z-D-ASN(MTT)-OH
CAS:200276-64-8
Formula: C32H30N2O5
522.60
ACM200276648
Z-D-ASN -OH, 200276-64-8
Z-D-ASN(TRT)-OH
CAS:200259-87-6
Formula: C31H28N2O5
508.57
ACM200259876
Z-D-ASP(OBZL)-OH
CAS:5241-62-3
Formula: C19H19NO6
357.36
ACM5241623
Z-D-Asp-OBzl, AC1L2IDL, SureCN2912586, AC1Q660W, MolPort-020-003-866, AKOS015908363, AK-49852, FT-0689482, (2R)-4-oxo-4-phenylmethoxy-2-(phenylmethoxycarbonylamino)butanoic acid, (2r)-4-(benzyloxy)-2-{[(benzyloxy)carbonyl]amino}-4-oxobutanoic acid(non-pre
Z-D-GLN(MTT)-OH
CAS:200716-85-4
Formula: C33H32N2O5
536.64
ACM200716854
Z-D-LEU-OSU
CAS:65581-25-1
Formula: C18H22H2O6
362.38
ACM65581251
Z-D-LYS-OBZL BENZENESULFONATE
CAS:201018-13-5
Formula: C27H32N2O7S
528.62
ACM201018135
N-ALPHA-CARBOBENZOXY-D-LYSINE BENZYL ESTER BENZENESULFONATE;Z-D-LYSINE BENZYL ESTER BENZENESULFONATE;Z-D-LYSINE-OBZL BENZENESULFONATE;Z-D-LYS-OBZL BENZENESULFONATE;Z-D-Lys-OBzl;Nalpha-Z-D-lysine benzyl ester Benzenesulfonate
Z-D-MEALA-OH
CAS:68223-03-0
Formula: C12H15NO4
237.25
ACM68223030
Z-D-ORN(BOC)-OH
CAS:98264-52-9
Formula: C18H26N2O6
366.41
ACM98264529
Z-D-ORN(Z)-OH
CAS:13594-49-5
Formula: C21H24N2O6
400.43
ACM13594495
Z-D-PHE-PHE-ARG(NO2)-OH
CAS:16088-35-0
Formula: C32H37N7O8
647.68
ACM16088350
Z-D-PRO-OSU
CAS:104055-24-5
Formula: C17H18N2O6
346.33
ACM104055245
Z-DL-ALA-GLY-OH
CAS:2503-31-3
Formula: C13H16N2O5
280.28
ACM2503313
Z-DL-ALANINE-N-HYDROXYSUCCINIMIDE ESTER
CAS:73488-77-4
Formula: C15H16N2O6
320.3
ACM73488774
NSC140819, AC1L61E3, CTK8G3821, AG-G-90683, MCULE-4629293107, NSC-140819, Z-DL-alanine-N-hydroxysuccinimide ester, BAS 00104181, FT-0641464, 2,5-dioxopyrrolidin-1-yl N-[(benzyloxy)carbonyl]alaninate, (2,5-dioxopyrrolidin-1-yl) 2-(phenylmethoxycarbonylamin
Z-DL-PHE(4-CL)-OH
CAS:55478-54-1
Formula: C17H16ClNO4
333.77
ACM55478541
Z-G-CARBOXY-G-(DI-TERT-BUTYL ESTER)-D-GLUTAMIC ACID
CAS:60868-52-4
Formula: C22H31NO8
437.52
ACM60868524
Z-GLN(DOD)-OH
CAS:28252-49-5
Formula: C28H30N2O7
506.56
ACM28252495
Z-GLN-GLY-OH
CAS:6610-42-0
Formula: C15H19N3O6
337.33
ACM6610420
Z-GLU(OBZL)-ONP
CAS:49689-66-9
Formula: C26H24N2O8
492.49
ACM49689669
Z-GLU(OBZL)-OSU
CAS:67413-34-7
Formula: C24H24N2O8
468.47
ACM67413347
Z-GLU(OME)-OSU
CAS:39538-31-3
Formula: C18H20N2O8
392.36
ACM39538313
Z-GLU(OSU)-OBZL
CAS:34897-67-1
Formula: C24H24N2O8
468.46
ACM34897671
Z-GLU(OSU)-OBZL, 34897-67-1, Z-GLU -OBZL, MolPort-028-959-444, AK170094, K-7923
Z-GLU-TYR-OET
CAS:101982-64-3
Formula: C24H28N2O8
472.49
ACM101982643
Z-GLU-TYR-OET
Z-GLY-GLY-ARG-4M-BETANA HCL
CAS:63424-41-9
Formula: C29H36ClN7O6
614.09
ACM63424419
Z-GLY-GLY-ARG-7-AMINO-4-METHYLCOUMARIN
CAS:102601-58-1
Formula: C28H33N7O7
579.6
ACM102601581
Z-Gly-Gly-Arg 7-amido-4-methylcoumarin hydrochloride, 102601-58-1, C9396_SIGMA, CTK8F0022, FT-0642491, N-CBZ-Glycyl-glycyl-L-arginine 7-amido-4-methylcoumarin hydrochloride
Z-GLY-GLY-ARG-BETANA HCL
CAS:1442-79-1
Formula: C28H34ClN7O5
584.07
ACM1442791
Z-GLY-GLY-GLY-GLY-GLY-OH
CAS:20228-72-2
Formula: C18H23N5O8
437.4
ACM20228722
Z-GLY-GLY-GLY-ONP
CAS:19811-64-4
Formula: C20H20N4O8
444.39
ACM19811644
Z-GLY-PHE-GLY-ALDEHYDE SEMICARBAZONE
CAS:102579-47-5
Formula: C22H26N6O5
454.48
ACM102579475
Z-GLY-PHE-GLY-ALDEHYDE SEMICARBAZONE
Z-GLY-PRO-GLY-GLY-PRO-ALA-OH
CAS:13075-38-2
Formula: C27H36N6O9
588.61
ACM13075382
EINECS 235-973-2, CID5486160, N-Carbobenzoxyglycyl-prolyl-glycyl-glycyl-prolyl-alanine, 13075-38-2, L-Alanine, N-(1-(N-(N-(1-(N-((phenylmethoxy)carbonyl)glycyl)-L-prolyl)glycyl)glycyl)-L-prolyl)-, N-(1-(N-(N-(1-(N-((Phenylmethoxy)carbonyl)glycyl)-L-prolyl
Z-GLY-PRO-LEU-GLY-PRO-OH
CAS:2646-61-9
Formula: C28H39N5O8
573.64
ACM2646619
Z-GLY-SAR-OH
CAS:7801-91-4
Formula: C13H16N2O5
280.28
ACM7801914
Z-GLY-SAR-OH
Formula: C13H15NO
280.28
ACM-00002350
Z-GLY-TYR-NH2
CAS:17263-44-4
Formula: C19H21N3O5
371.39
ACM17263444
Z-GLY-TYR-OH
CAS:7801-35-6
Formula: C19H20N2O6
372.37
ACM7801356
Z-GUGGULSTERONE
CAS:39025-23-5
Formula: C21H28O2
312.45
ACM39025235
Guggulsterone
Z-HIS-OME
CAS:15545-10-5
Formula: C15H17N3O4
303.31
ACM15545105
Z-HIS-PHE-TRP-OET
CAS:10119-01-4
Formula: C36H38N6O6
650.72
ACM10119014
Z-HIS-PHE-TRP-OET;N-ALPHA-CARBOBENZOXY-L-HISTIDYL-PHENYLALANYL-L-TRYPTOPHANETHYL ESTER
Z-ILE-ILE-OH
CAS:42538-01-2
Formula: C20H30N2O5
378.46
ACM42538012
EINECS 255-876-9, CID6451893, N-(N-((Benzyloxy)carbonyl)-L-isoleucyl)-L-isoleucine, 42538-01-2
Z-ILE-ONP
CAS:2130-99-6
Formula: C20H22N2O6
386.41
ACM2130996
Z-ILE-PRO-OH
CAS:13211-37-5
Formula: C19H26N2O5
362.42
ACM13211375
Z-L-2-AMINOHEXANOIC ACID-P-NITROPHENYL ESTER
CAS:24181-97-3
Formula: C20H22N2O6
386.41
ACM24181973
Z-L-ASPARTIC ACID B-N-HYDROXYSUCCINIMIDE ESTER A-METHYL ESTER
CAS:54743-84-9
Formula: C17H18N2O8
378.34
ACM54743849
Z-ASP(OSU)-OME, MolPort-020-004-620, K-9849, 54743-84-9
Z-L-NORLEUCINE N-HYDROXYSUCCINIMIDE ESTER
CAS:36360-62-0
Formula: C18H22N2O6
362.39
ACM36360620
Z-NLE-OSU, 36360-62-0, SCHEMBL11285763, MolPort-020-004-484, K-8126
Z-L-NORVALINE N-HYDROXYSUCCINIMIDE ESTER
CAS:71447-85-3
Formula: C17H20N2O6
348.36
ACM71447853
71447-85-3, Z-NVA-OSU, SCHEMBL11288027, MolPort-028-959-331, KM1409, Z-L-NORVALINE N-HYDROXYSUCCINIMIDE ESTER
Z-L-PHENYLALANINOL O-(P-TOLUENESULFONATE)
CAS:194935-55-2
Formula: C24H25NO5S
439.52
ACM194935552
Z-L-phenylalaninol O-(p-toluenesulfonate), (S)-2-(Z-amino)-3-phenylpropyl p-toluenesulfonate, 03554_FLUKA, 194935-55-2
Z-L-PYROGLUTAMIC ACID N-HYDROXYSUCCINIMIDE ESTER
CAS:40291-26-7
Formula: C17H16N2O7
360.33
ACM40291267
(S)-1-Benzyl 2-(2,5-dioxopyrrolidin-1-yl) 5-oxopyrrolidine-1,2-dicarboxylate, 40291-26-7, AC1LZ71G, Oprea1_526378, CTK8B7526, ANW-57577, AKOS016001415, AG-F-42775, AK-67830, 1-O-benzyl 2-O-(2,5-dioxopyrrolidin-1-yl) (2S)-5-oxopyrrolidine-1,2-dicarboxylate
Z-L-TYR(TBU)-OH
CAS:5545-54-0
Formula: C21H25NO5
371.43
ACM5545540
Z-LEU-LEU-OH
CAS:7801-71-0
Formula: C20H30N2O5
378.46
ACM7801710
Z-LIGUSTILIDE
CAS:81944-09-4
Formula: C12H14O2
190.23836
ACM81944094
cis-Ligustilide;Ligustilide A;(3Z)-3-Butylidene-4,5-dihydro-1(3H)-isobenzofuranone;LIGUSTILIDE, Z-(IN ACETONITRILE)(10.2Mg/ML)(P)
Z-LYS(AC)-NH2
CAS:218938-54-6
Formula: C16H23N3O4
321.38
ACM218938546
NSC164075, AC1L6MZJ, AC1Q2UMB, CTK8E7584, Z-Nepsilon-acetyl-L-Lysine amide, NSC-164075, benzyl N-{1-[(1-carbamoylbutyl)carbamoyl]ethyl}carbamate, benzyl N-[1-[(1-amino-1-oxopentan-2-yl)amino]-1-oxopropan-2-yl]carbamate, 218938-54-6
Z-LYS(BOC)-OH
CAS:2389-60-8
Formula: C19H28N2O6
380.44
ACM2389608
N-CBZ-N-EPSILON-BOC-L-LYSINE;NEPSILON-BOC-NALPHA-CBZ-L-LYSINE;NEPSILON-(TERT-BUTOXYCARBONYL)-NALPHA-CARBOBENZOXY-L-LYSINE;N-BENZYLOXYCARBONYL-N-EPSILON-TERT-BUTOXYCARBONYL-L-LYSINE;N-ALPHA-BENZYLOXYCARBONYL-N-EPSILON-T-BUTYLOXYCARBONYL-L-LYSINE;N-ALPHA-BE
Z-LYS(TOS)-ONP
CAS:16879-94-0
Formula: C27H29N3O8S
555.61
ACM16879940
Z-LYS(Z)-GLY-OH
CAS:37941-54-1
Formula: C24H29N3O7
471.51
ACM37941541
Z-LYS -GLY-OH, 37941-54-1
Z-LYS-NH2 HCL
CAS:112785-42-9
Formula: C14H21N3O3.ClH
315.8
ACM112785429
SureCN3176223, CTK8E9581, Nalpha-Z-L-lysine amide hydrochloride, 112785-42-9
Z-LYS-ONP HCL
CAS:2179-15-9
Formula: C20H24ClN3O6
437.87
ACM2179159
Z-N-ME-DL-ALA-OH DCHA
CAS:91738-83-9
Formula: C12H23N.C12H15NO4
418.6
ACM91738839
91738-83-9, Z-N-ME-DL-ALA-OHDCHA, Z-N-ME-DL-ALA-OH DCHA, MolPort-020-003-961, KM3057
Z-N-ME-SER(TBU)-OH DCHA
CAS:117106-19-1
Formula: C16H23NO5C12H23N
490.68
ACM117106191
Z-N-ME-THR(TBU)-OH CHA
CAS:42417-73-2
Formula: C17H25NO5C6H13N
422.57
ACM42417732
Z-ORN(BOC)-OH
CAS:199924-46-4
Formula: C18H26N2O6
366.41
ACM199924464
Z-ORN(BOC)-OH DCHA
CAS:13665-13-9
Formula: C30H49N3O6
547.73
ACM13665139
13665-13-9, Z-ORN(BOC)-OH DCHA, MolPort-020-003-947, AKOS024259140, AK-89014, K-4389, Dicyclohexylamine (S)-2-(((benzyloxy)carbonyl)amino)-5-((tert-butoxycarbonyl)amino)pentanoate
Z-ORN(FMOC)-OH
CAS:201048-68-2
Formula: C28H28N2O6
488.55
ACM201048682
Z-ORN(Z)-OSU
CAS:90970-61-9
Formula: C25H27N3O8
497.51
ACM90970619
Z-PHE-ARG-4M-BETANA HCL
CAS:100900-17-2
Formula: C34H39ClN6O5
647.16
ACM100900172
Z-PHE-ARG-4M-BETANA HCL;N-cbz-phe-arg 4-methoxy-B-naphthylamide hydrochlo;N-CBZ-PHE-ARG 4-METHOXY-B-NAPHTHYLAMIDE HYDROCHLORID;N-CBZ-Phe-Arg-4-methoxy-beta-naphthylamide hydrochloride;Z-FR-MNA;Z-Phe-Arg 4-methoxy--naphthylamide hydrochloride
Z-PHE-GLY-OH
CAS:13122-99-1
Formula: C19H20N2O5
356.37
ACM13122991
Z-Phe-Gly, Carbobenzoxyphenylalanylglycine, MLS000689728, C3147_SIGMA, MolPort-001-824-116, CID98101, NSC76846, EINECS 236-052-8, NSC 76846, N-carbobenzyloxy-dl-phenalaninylglycine, N-[(benzyloxy)carbonyl]phenylalanylglycine, SMR000313332, LT00771851, N-(
Z-PHE-MET-OH
CAS:13126-07-3
Formula: C22H26N2O5S
430.52
ACM13126073
Z-PHE-ONP
CAS:2578-84-9
Formula: C23H20N2O6
420.42
ACM2578849
Z-PHE-OTBU
CAS:7670-20-4
Formula: C21H25NO4
355.43
ACM7670204
Z-PHE-TRP-OH
CAS:16856-28-3
Formula: C28H27N3O5
485.53
ACM16856283
Z-PHG-OSU
CAS:146118-22-1
Formula: C20H18N2O6
382.37
ACM146118221
Z-PRO-ALA-GLY-PRO-4MBNA
CAS:100900-21-8
Formula: C34H39N5O7
ACM100900218
Z-PRO-BETANA
CAS:86925-99-7
Formula: C23H22N2O3
374.43
ACM86925997
SureCN4613461, Z-L-proline beta-naphthylamide, CTK8G3868, AG-H-50446, 86925-99-7
Z-PRO-GLY-OH
CAS:2766-18-9
Formula: C15H18N2O5
306.31
ACM2766189
Z-PRO-PHE-HIS-LEU-LEU-VAL-TYR-SER-4M-BETANA
CAS:100900-43-4
Formula: C68H85N11O13
1264.47
ACM100900434
Z-PRO-PHE-HIS-LEU-LEU-VAL-TYR-SER-4M-BETANA
Z-PRO-PROLINAL
CAS:86925-97-5
Formula: C18H22N2O4
330.38
ACM86925975
benzyl (2S)-2-[(2S)-2-formylpyrrolidine-1-carbonyl]pyrrolidine-1-carboxylate
Z-SAR-OH
Formula: C11H13ClO3
223.23
ACM-00002155
Z-SAR-OSU
CAS:53733-96-3
Formula: C15H16N2O6
320.3
ACM53733963
Z-SER(BZL)-OSU
CAS:98647-23-5
Formula: C22H22N2O7
426.42
ACM98647235
CHEMBL204200, Z-SER(BZL)-OSU, MolPort-020-004-635, KM3481, 98647-23-5
Z-SER(TBU)-OSU
CAS:19460-97-0
Formula: C19H24N2O7
392.4
ACM19460970
AmbotzZAA1246, Z-L-Ser(tBu)-OSu, CTK8G3870, AG-E-42249, 19460-97-0, Carbamicacid, [(1S)-1-[(1,1-dimethylethoxy)methyl]-2-[(2,5-dioxo-1-pyrrolidinyl)oxy]-2-oxoethyl]-,phenylmethyl ester (9CI); Carbamic acid,[1-[(1,1-dimethylethoxy)methyl]-2-[(2,5-dioxo-1-p
Z-SER-NH2
CAS:70897-15-3
Formula: C11H14N2O4
238.24
ACM70897153
Z-THR(TBU)-OSU
CAS:10068-65-2
Formula: C20H26N2O7
406.43
ACM10068652
BENZYLOXYCARBONYL-O-T-BUTYL-L-THREONINE N-HYDROXYSUCCINIMIDE ESTER; Cbz-Thr(tBu)-OSU; Z-L-Thr(OtBu)-OSu; Z-L-Thr(tBu)-OSu; Z-Thr(But)-ONSu; Z-THREONINE(TBU)-OSU; Z-O-T-BUTYL-L-THREONINE N-HYDROXYSUCCINIMIDE ESTER; Z-THR(BUT)-OSU;
Z-TRP-OME
CAS:2717-76-2
Formula: C20H20N2O4
352.38
ACM2717762
Z-TRP-OME;(S)-methyl 2-(benzyloxycarbonylamino)-3-(1H-indol-3-yl)propanoate;Cbz-L-Tryptophan-methyl ester;Z-L-tryptophan beta-Methyl ester;N-Carbobenzoxy-L-tryptophan methyl ester;Cbz-L-Trp-OMe
Z-TRP-ONP
CAS:16624-64-9
Formula: C25H21N3O6
459.46
ACM16624649
Z-TYR(3,5-I2)-OET
CAS:102202-92-6
Formula: C19H19I2NO5
595.17
ACM102202926
Z-TYR(BZL)-OSU
CAS:52773-66-7
Formula: C28H26N2O7
502.52
ACM52773667
EINECS 258-168-8, CID6452726, 52773-66-7, Benzyl (S)-(2-((2,5-dioxo-1-pyrrolidinyl)oxy)-2-oxo-1-((4-(benzyloxy)phenyl)methyl)ethyl)carbamate, Carbamic acid, (2-((2,5-dioxo-1-pyrrolidinyl)oxy)-2-oxo-1-((4-(phenylmethoxy)phenyl)methyl)ethyl)-, phenylmethyl
Z-TYR(TBU)-OSU
CAS:10068-67-4
Formula: C25H28N2O7
468.5
ACM10068674
Z-TYR-OET
CAS:16679-94-0
Formula: C19H21NO5
343.37
ACM16679940
N-ALPHA-CARBOBENZOXY-L-TYROSINE ETHYL ESTER;Z-TYR-OET;Z-L-TYROSINE ETHYL ESTER;CBZ-L-TYROSINE ETHYL ESTER;(S)-ethyl 2-(benzyloxycarbonylamino)-3-(4-hydroxyphenyl)propanoate;CBZ-Tyr-OEt
Z-TYR-SER-OH
CAS:20448-71-9
Formula: C20H22N2O7
402.4
ACM20448719
Z-TYR-SER-OME
CAS:15364-45-1
Formula: C21H24N2O7
416.42
ACM15364451
Z-VAL-ONP
CAS:10512-93-3
Formula: C19H20N2O6
372.38
ACM10512933
Z-VAL-PHE-OH
CAS:19542-51-9
Formula: C22H26N2O5
398.45
ACM19542519
Z-VAL-TRP-OH
CAS:18904-53-5
Formula: C24H27N3O5
437.49
ACM18904535
Z-VAL-VAL-ARG-AMC
CAS:124485-41-2
Formula: C34H45N7O7
663.76
ACM124485412
Z-VAL-VAL-OH
CAS:19542-54-2
Formula: C18H26N2O5
350.41
ACM19542542
Z-VAL-VAL-OH;Z-L-VALYL-L-VALINE
ZABICIPRIL
CAS:83059-56-7
Formula: C23H32N2O5
416.515
ACM83059567
Zabicipril, UNII-475035SS4C, (3s)-2-{n-[(2s)-1-ethoxy-1-oxo-4-phenylbutan-2-yl]-l-alanyl}-2-azabicyclo[2.2.2]octane-3-carboxylic acid, 83059-56-7, Zabiciprilum, Zabiciprilum [Latin], AC1L2FUN, AC1Q63IC, SCHEMBL636681, CHEMBL2106476, KST-1A8702, AR-1A4467,
ZACOPRIDE HYDROCHLORIDE HYDRATE
CAS:101303-98-4
Formula: C15H21Cl2N3O2
346.25 (anhydrous basis)
ACM101303984
4-Amino-N-1-azabicyclo[2.2.2]oct-3-yl-5-chloro-2-methoxybenzamide hydrochloride hydrate
ZAMIFENACINFUMARATE
CAS:127308-98-9
Formula: C27H29NO3.C4H4O4
531.602
ACM127308989
ZAMIFENACIN FUMARATE, CTK8E6939, 127308-98-9
ZAPOTIN
CAS:14813-19-5
Formula: C19H18O6
342.34
ACM14813195
Zapotin; 2-(2,6-dimethoxy-phenyl)-5,6-dimethoxy-chromen-4-one; 5,6,2,6-tetramethoxy-flavone; 2-(2,6-Dimethoxy-phenyl)-5,6-dimethoxy-chromen-4-on; Flavone,2,5,6,6-tetramethoxy;
ZARAGOZIC ACID A TRISODIUM SALT
CAS:144541-82-2
Formula: C35H46Na3O14
756.68
ACM144541822
ZBC
CAS:136-23-2
Formula: C18H36N2S4Zn
474.14
ACM136232
(dibutyldithiocarbamato)zinc(ii);accelbz;acetozdbd;bis(dibutylcarbamodithioato-S,S')-,(T-4)-Zinc;bis(dibutyldithiocarbamato)-zin;bis(n,n-dibutyldithiocarbamato)zinc;butazate;butazate50-d
ZBC
CAS:136-23-2
Formula: C18H36N2S4Zn
474.14
ACM136232
(dibutyldithiocarbamato)zinc(ii);accelbz;acetozdbd;bis(dibutylcarbamodithioato-S,S')-,(T-4)-Zinc;bis(dibutyldithiocarbamato)-zin;bis(n,n-dibutyldithiocarbamato)zinc;butazate;butazate50-d
ZD 7114 HYDROCHLORIDE
CAS:129689-28-7
Formula: C22H31ClN2O6
454.94
ACM129689287
ZD 7114 hydrochloride, SureCN2343849, CCG-221889, AK-57241, (S)-2-(4-(2-((2-Hydroxy-3-phenoxypropyl)amino)ethoxy)phenoxy)-N-(2-methoxyethyl)acetamide hydrochloride, 129689-28-7, Acetamide, 2-[4-[2-[[(2S)-2-hydroxy-3-phenoxypropyl]amino]ethoxy]phenoxy]-N-(
ZEARALANONE
CAS:5975-78-0
Formula: C18H24O5
320.38
ACM5975780
2,4-DIHYDROXY-6-[10-HYDROXY-6-OXO-UNDECYL]BENZOIC ACID MICRO-LACTONE;ZEARALANONE;2,4-Dihydroxy-6-(10-hydroxy-6-oxoundecyl)benzoicacid-lactone;(S)-3,4,5,6,9,10,11,12-Octahydro-14,16-dihydroxy-3-methyl-1H-2-benzoxacyclotetradecin-1,7(8H)-dione;(S)-Zearalan
ZEARALENONE
CAS:17924-92-4
Formula: C18H22O5
318.36
ACM17924924
(E)-(S)-2,4-DIHYDROXY-7-METHYL-7,8,9,10,13,14-HEXAHYDRO-12H-6-OXA-BENZOCYCLOTETRADECENE-5,11-DIONE;3,4,5,6,9,10-HEXAHYDRO-14,16-DIHYDROXY-3-METHYL-1H-2-BENZOXACYCLOTETRADECIN-1,7(8H)-DIONE;MYCOTOXIN F2;ZON;ZENONE;ZEARALENONE;(10s)-zearalenone;(e)--methyl-
ZEARALENONE SS-D-GLUCURONIDEDISCONTINUED
CAS:1032558-19-2
Formula: C24H30O11
494.49
ACM1032558192
(3S,11E)-3,4,5,6,7,8,9,10-Octahydro-16-hydroxy-3-methyl-1,7-dioxo-1H-2-benzoxacyclotetradecin-14-yl -D-Glucopyranosiduronic Acid
ZEAXANTHIN
CAS:144-68-3
Formula: C40H56O2
568.87
ACM144683
4-[18-(4-hydroxy-2,6,6-trimethyl-1-cyclohexenyl)-3,7,12,16-tetramethyl-octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]-3,5,5-trimethyl-cyclohex-3-en-1-ol;(3R,3R)-BETA,BETA-CAROTEN-3,3-DIOL;(3R,3R)-beta,beta-Carotene-3,3-diol;B,B-CAROTENE-3,3DIOL;BETA,BETA-CAROTE
ZEIN,PURIFIED
CAS:9010-66-6
35000
ACM9010666
ZEINOXANTHIN
CAS:472-69-5
0
ACM472695
ZEINOXANTHIN
ZEOLITE 13X
CAS:63231-69-6
Formula: Na86[(AlO2)86(SiO2)106].XH2O
318.299987792969
ACM63231696
ZEOLITE NAA
CAS:68989-22-0
ACM68989220
ethacal;hab40;hab-a40;mizukalizerds;molequlite401;siltonb;valfor100;wessalithp
ZEOLITE,HS-320,HYDROGEN Y
CAS:308081-05-2
ACM308081052
ZEOLITE,HS-720,POTASSIUM FERRIERITE
CAS:308066-04-8
0
ACM308066048
ZEOLITE, HS-720, POTASSIUM FERRIERITE;ZEOLITE, SYNTHETIC, HS-720, POWDER, POTASSIUM FERRIERITE;Zeolite,Synthetic,HS-720,Power,PotassiumFerrierite
ZEOLITE3A
CAS:308080-99-1
Formula: Na2O Al2O3 2.0SiO2 4.5H2O
ACM308080991
ZERUMBONE
CAS:471-05-6
Formula: C15H22O
218.33
ACM471056
ZERUMBONE ((2E,6E,10E)-2,6,9,9-TETRAMETHYLCYCLOUNDECA-2,6,10-TRIEN-1-ONE); Zerumbone;
ZIDOVUDINE
CAS:30516-87-1
Formula: C10H13N5O5
283.24
ACM30516871
3-AZIDO-3-DEOXYTHYMIDINE;1-(4-azido-5-hydroxymethyl-tetrahydro-furan-2-yl)-5-methyl-1h-pyrimidine-2,4-dione;1-((2R,4S,5S)-4-AZIDO-5-HYDROXYMETHYL-TETRAHYDRO-FURAN-2-YL)-5-METHYL-1H-PYRIMIDINE-2,4-DIONE;AZT;AZIDOTHYMIDINE;ZIDOVUDINE;3'-azido-3'-deoxy-thymi
ZIDOVUDINE RELATED COMPOUND B (25 MG) (3-CHLORO-3-DEOXYTHYMIDINE)
CAS:25526-94-7
ACM25526947
ZILEUTON
CAS:111406-87-2
Formula: C11H12N2O2S
236.29
ACM111406872
()-N-hydroxy-N-(1-benzo[b]thien-2-ylethyl)urea
ZILPATEROL
CAS:113827-79-9
ACM113827799
ZILPATEROL HYDROCHLORIDE
CAS:119520-06-8
Formula: C14H19N3O2.HCl
297.78
ACM119520068
Zilpaterol Hcl;(+/1)-trans-4,5,6,7-Tetrahydro-7-hydroxy-6-(isopropylamino)imidazo[4,5,1-jk]-[1]benzazepin-2(1H)-one hydrochloride;(+/1)-trans-4,5,6,7-Tetrahydro-7-hydroxy-6-(isopropylamino)imidazo[4,5,1-jk]-[1]benzazepin-2(1H)-one hydrochloride;Zilpaterol
ZIMELIDINE DIHYDROCHLORIDE SEROTONIN UPT AKE INHI
CAS:61129-30-4
Formula: C16H17BrN2??2HCl
390.15
ACM61129304
Zimeldine hydrochloride, Normud, Zelmid, Zimelidine dihydrochloride monohydrate, DSSTox_CID_25815, DSSTox_RID_81152, DSSTox_GSID_45815, 61129-30-4, Zimelidine hydrochloride, ZIMELDINE DIHYDROCHLORIDE HYDRATE, NCGC00094515-01, Zelmidine, Prestwick_901, CAS
ZINC 1,2,3,4,8,9,10,11,15,16,17,18,22,23,24,25-HEXADECAFLUORO-29H,31H-PHTHALOCYANINE
CAS:31396-84-6
Formula: C32F16N8Zn
865.76
ACM31396846
ZINC 1,2,3,4,8,9,10,11,15,16,17,18,22,23,24,25-HEXADECAFLUORO-29H,31H-PHTHALOCYANINE;zinc 1,2,3,4,8,9,10,11,15,16,17,18,22,23;ZINC 1,2,3,4,8,9,10,11,15,16,17,18,22,23 , 24,25-HEXADECAFLUORO-PHTHALOCYANINE;Zinc 1,2,3,4,8,9,10,11,15,16,17,18,22,23,24,25-hex
ZINC 1,4,8,11,15,18,22,25-OCTABUTOXY-PHTHALOCYANINE
CAS:107227-89-4
Formula: C64H80N8O8Zn
1154.77
ACM107227894
ZINC 1,4,8,11,15,18,22,25-OCTABUTOXY- PHTHALOCYANINE;zinc1,4,8,11,15,18,22,25-octa-n-butoxyphthalocyanine;zinc 1,4,8,11,15,18,22,25-octabutoxy-29H,31H-phthalocyanin
ZINC 2 3 9 10 16 17 23 24-OCTAKIS(OCTYL&
CAS:261504-18-1
Formula: C96H144N8O8Zn
1603.63
ACM261504181
ZINC 2 3 9 10 16 17 23 24-OCTAKIS(OCTYL&;Zinc 2,3,9,10,16,17,23,24-octakis(octyloxy)-29H,31H-phthalocyanine Dye content 95 %
ZINC 2,11,20,29-TETRA-TERT-BUTYL-2,3-NAPHTHALOCYANINE
CAS:39049-43-9
Formula: C64H56N8Zn
1002.57
ACM39049439
ZINC 2,11,20,29-TETRA-TERT-BUTYL-2,3-NAPHTHALOCYANINE;zinc 2,11,20,29-tetra-tert-butyl-2,3-naphthalocya;Zinc 2,11,20,29-tetra-tert-butyl-2,3-naphthalocyanine Dye content 90 %
ZINC 2,11,20,29-TETRA-TERT-BUTYL-2,3-NAPHTHALOCYANINE
CAS:39049-43-9
Formula: C64H56N8Zn
1002.57
ACM39049439
ZINC 2,11,20,29-TETRA-TERT-BUTYL-2,3-NAPHTHALOCYANINE;zinc 2,11,20,29-tetra-tert-butyl-2,3-naphthalocya;Zinc 2,11,20,29-tetra-tert-butyl-2,3-naphthalocyanine Dye content 90 %
ZINC 2,9,16,23-TETRA-TERT-BUTYL-29H,31H-PHTHALOCYANINE
CAS:39001-65-5
Formula: C48H48N8Zn
802.34
ACM39001655
tetra(tert-butyl)phthalocyaninato zinc; zinc tetra(tert-butylbenzo)porphyrazine; zinc (toluene-3,4-dithiolate); zinc(II) tetra-tert-butylphthalocyanine;
ZINC 5,10,15,20-TETRA(4-PYRIDYL)-21 H,23 H-PORPHINE
CAS:31183-11-6
Formula: C40H24N8Zn
682.06
ACM31183116
ZINC 5,10,15,20-TETRA(4-PYRIDYL)-21 H,23 H-PORPHINE
ZINC 5,10,15,20-TETRA(4-PYRIDYL)-21 H,23 H-PORPHINE
CAS:31183-11-6
Formula: C40H24N8Zn
682.06
ACM31183116
ZINC 5,10,15,20-TETRA(4-PYRIDYL)-21 H,23 H-PORPHINE
ZINC ACETATE
CAS:557-34-6
Formula: C4H6O4Zn;
183.468g/mol
ACM557346
AC1L1WTG; Zinc di(acetate); Zinc acetate, 99%, pure; Acetic acid, zinc salt; Zinc Acetate (anhydrous); 2C2H3O2.Zn; Zinc acetate [USAN]; Dicarbomethoxyzinc; AKOS015837576; E650;
ZINC ACETATE DIHYDRATE
CAS:5970-45-6
Formula: C4H6O4Zn ? 2H2O;C4H10O6Zn;
219.498g/mol
ACM5970456
Galzin (TN); DTXSID5021461; MFCD00066961; I14-0694; KSC492I2L; FM5526K07A; CAS-5970-45-6; Acetic acid, zinc salt, dihydrate; RTR-020686; AB1009270;
ZINC ACETYLACETONATE HYDRATE
CAS:108503-47-5,14024-63-6
Formula: C10H16O4Zn;
265.614g/mol
ACM10850347514024636
Zinc acetylacetonate hydrate;Zinc(II) acetylacetonate;108503-47-5;C10H14O4Zn;ACN-S002695;5725AF;
ZINC ACETYLACETONATE HYDRATE
CAS:108503-47-5
ACM108503475-1
ZINC ACETYLACETONATE, 99%
CAS:14024-63-6
Formula: C10H14O4Zn
264
ACM14024636
BIS(2,4-PENTANEDIONATO)ZINC(II);BIS(ACETYLACETONATO)ZINC(II);2,4-PENTANEDIONE ZINC DERIVATIVE;ACETYLACETONE, ZINC DERIVATIVE;ACETYLACETONE ZINC(II) SALT;ZINC(II) ACETYLACETONATE;ZINC 2,4-PENTANEDIONATE;ZINC ACETYLACETONATE
ZINC AMMONIUM CHLORIDE
CAS:52628-25-8
Formula: Cl5H12N3Zn
118.8816
ACM52628258
Zinc ammonium chloride;Zinc ammonium chloride solutions
ZINC BENZOATE
CAS:553-72-0
Formula: C14H10O4Zn
307.62
ACM553720
ZINC BENZOATE;Benzoicacid,zincsalt;zinc dibenzoate ;Zinkdibenzoat;Bisbenzoic acid zinc salt;Dibenzoic acid zinc salt;Benzoic acid, zinc salt(2:1)
ZINC BENZYLSULFINATE
CAS:21799-75-7
375.78
ACM21799757
ZINC BIS(2-ETHYLHEXYL) PHOSPHORODITHIOATE
CAS:4259-15-8
Formula: C32H89O4P2S4Zn
772.47
ACM4259158
Bis(2-ethylhexyl) phosphorodithioate Zinc Salt
ZINC BIS(ACETATO-O)DIOXOURANATE
CAS:10138-94-0
Formula: C4H6O6UZn
ACM10138940
zinc bis(acetato-O)dioxouranate;URANYL ZINC ACETATE GR
ZINC BIS(BENZENESULPHINATE)
CAS:24308-84-7
Formula: Zn(C6H5O2S)2?2(H2O)
383.76
ACM24308847
BENZENESUIFINIC ACID ZINC SALT;BENZENESULFINIC ACID ZINC SALT DEHYDRATE;BENZENESULFINIC ACID ZINC SALT DIHYDRATE;zincbenzenesulfinate;zincbis(benzenesulfinate);ZINC BENZENESULFINATE DIHYDRATE;ZBS;zinc bis(benzenesulphinate)
ZINC BIS[(PHENYLSULFONYL)METHANESULFINATE]
503.91
ACM-00013852
ZINC BIS[BIS(TRIMETHYLSILYL)AMIDE]
CAS:14760-26-0
Formula: C12H36N2Si4Zn;
386.154g/mol
ACM14760260-1
Bis[bis(trimethylsilyl)amino] zinc; DTXSID20193044; KS-000018R1; AC1L3C2A; 14760-26-0; SCHEMBL175413;
ZINC BORATE
CAS:10361-94-1
Formula: B2O6Zn3;
313.754g/mol
ACM10361941
BIKXLKXABVUSMH-UHFFFAOYSA-N; Diboron zinc tetraoxide; EINECS 238-763-9; Boric acid, zinc salt; Bonrex FC; AC1L4ZF4; trizinc diborate; Zin cborate; DTXSID6091554; ZINC BORATE;
ZINC BORATE
CAS:149749-62-2
ACM149749622
ZINC BORATE
CAS:10192-46-8
Formula: B2H6O6Zn3-6
319.83604
ACM10192468
diboron trizinc hexaoxide
ZINC BORATE 2335
CAS:138265-88-0
Formula: B6O11Zn2
371.64
ACM138265880
FIREBRAKE(R) 415;FIREBRAKE(R) 500;FIREBRAKE(R) ZB;BOROGARD(R) ZB;BORON ZINC HYDROXIDE OXIDE;ZINC BORATE EP;Boron zinc hydroxide oxide (B12Zn4(OH)14O15)
ZINC BROMIDE
CAS:7699-45-8
Formula: ZnBr2;Br2Zn;
225.188g/mol
ACM7699458
AKOS015833001; KSC378M6N; ZINCBROMIDE; Zinc bromide, 99.999%, (trace metal basis), extra pure; KS-00000VMF; I14-16498; zinc (II) bromide; CTK2H8666; 7699-45-8; RP27586;
ZINC BROMIDE DIHYDRATE99
CAS:18921-13-6
Formula: Br2H4O2Zn
261.22856
ACM18921136
ZINC BROMIDE DIHYDRATE99;zinc(ii)bromidedihydrate;Zinc bromide dihydrate 99%
ZINC CADMIUM SULFIDE
CAS:11129-14-9
Formula: CdS2Zn
241.93
ACM11129149
ZINC CADMIUM SULFIDE;ZINC CADMIUM SULFIDE FLUORESCENT;Cadmium zinc sulfide;Einecs 234-372-2
ZINC CARBONATE
CAS:3486-35-9
Formula: CO3Zn
125.39
ACM3486359
Zinc monocarbonate
ZINC CARBONATE HYDROXIDE
CAS:5970-47-8
Formula: C2H6O12Zn5
548.96
ACM5970478
ZINC CARBONATE HYDROXIDE
CAS:5263-02-5
Formula: C2H6O12Zn5
548.92
ACM5263025
ZINC CARBONATE BASIC; Zinc carbonate hydroxide,powder; Zinc Carbonate Basic;
ZINC CHLORIDE
CAS:7646-85-7
ACM7646857-1
ZINC CHLORIDE TETRAHYDROFURAN COMPLEX (1:2)
CAS:24640-76-4
Formula: C8H16Cl2O2Zn;
280.494g/mol
ACM24640764
24640-76-4;Dichlorozinc--oxolane (1/2);Dichlorobis(tetrahydrofuran)zinc;DTXSID50508662;ZINC CHLORIDE TETRAHYDROFURAN COMPLEX;Zinc chloride tetrahydrofuran complex (1:2);Zinc chloride tetrahydrofuran complex (1:2), 97%;
ZINC CHLOROETHANESULFINATE
CAS:54697-44-8
320.53
ACM54697448
ZINC CHLOROMETHANESULFINATE
CAS:55066-41-6
292.48
ACM55066416
ZINC CHLOROTHIOPHENOLATE
CAS:117-97-5
Formula: C12Cl10S2Zn;
628.132g/mol
ACM117975
bis(perchlorophenylthio)zinc; zinc,2,3,4,5,6-pentachlorobenzenethiolate; pentachlorothiophenol,zincsalt; PubChem13581; bis((pentachlorophenyl)thio),zincsalt; 117Z975; Zinc salt of penta chloro thiophenol; pentachloro-benzenethiozincsalt;
ZINC CITRATE DIHYDRATE
CAS:5990-32-9
Formula: C12H14O16Zn3
610.4
ACM5990329
ZINC CITRATE DIHYDRATE;ZINC CITRATE TRIBASIC DIHYDRATE;CITRIC ACID ZINC SALT DIHYDRATE;Citric acid zinc salt;ZINC CITRATE, DIHYDRATE REAGENT;zinc citrate dihydrate, reagent grade;Zinc citrate dihydrate, Reagent Grade, Zn 31% min;ZINC CITRATE pure
ZINC DI[BIS(TRIFLUOROMETHYLSULFONYL)IMIDE]
CAS:168106-25-0
Formula: C4H4F12N2O8S4Zn+2;
629.683g/mol
ACM168106250
Zinc bis(trifluoromethylsulfonyl)imide;Zinc triflimide;168106-25-0;AKOS024258832;AK154842;
ZINC DIACRYLATE
CAS:14643-87-9
Formula: 2(C3H3O2).Zn
207.48
ACM14643879
ZINC DIBUTYL BIS[[[3,5-BIS(1,1-DIMETHYLETHYL)-4-HYDROXYPHENYL]METHYL]PHOSPHONATE]
CAS:10175-95-8
Formula: C38H64O8P2Zn
776.237484 [g/mol]
ACM10175958
ZINC DIETHOXIDE
CAS:3851-22-7
Formula: C4H10O2Zn
155.51
ACM3851227
ZINC DIETHOXIDE;zinc diethanolate;ZINC DIETHOXIDE: 99.99%;Diethoxyzinc
ZINC DIETHYLDITHIOCARBAMATE
CAS:14324-55-1
Formula: C10H20N2S4Zn;
361.904g/mol
ACM14324551
Zinc diethyl dithiocarbamate; Tox21_200263; Zinc bis(diethyldithiocarbamate); KSC491A8F; Zinc diethyldithiocarbamate; CHEMBL3182813; ACMC-1C68I; AC1L1BJX; Ethyl zimate; J-007778;
ZINC DIFLUOROMETHANESULFINATE
CAS:1355729-38-2
Formula: C2H2F4O4S2Zn;
295.528g/mol
ACM1355729382
Zinc difluoromethanesulfinate;1355729-38-2;SCHEMBL14992879;MFCD23134675;Bis(difluoromethanesulfinic acid) zinc salt;
ZINC DILAURATE
CAS:2452-01-9
Formula: C24H46O4Zn
464.01
ACM2452019
ZINC LAURATE;Dodecanoicacid,zincsalt;zinc dilaurate;Zinkdilaurat;Bisdodecanoic acid zinc salt;Di(dodecanoic acid)zinc salt;zinc dodecanoate
ZINC DISODIUM EDTA
CAS:14025-21-9
Formula: C10H12N2Na2O8Zn
399.58
ACM14025219
Zinc disodium EDTA;zinc disodium ethylenediaminetetraacetate;[[N,N'-1,2-ethanediylbis[N-(carboxymethyl)glycinato]](4-)-N,N',O,O',ON,ON']-,disodium,(OC-6-Zincate(2-);ethylenediaminetetraaceticacidzinc*disodium;SodiumzincEDTA;IDRANAL(R) II-ZINC;(ETHYLENEDIN
ZINC DISODIUM EDTA
CAS:14025-21-9
Formula: C10H12N2Na2O8Zn
399.58
ACM14025219
Zinc disodium EDTA;zinc disodium ethylenediaminetetraacetate;[[N,N'-1,2-ethanediylbis[N-(carboxymethyl)glycinato]](4-)-N,N',O,O',ON,ON']-,disodium,(OC-6-Zincate(2-);ethylenediaminetetraaceticacidzinc*disodium;SodiumzincEDTA;IDRANAL(R) II-ZINC;(ETHYLENEDIN
ZINC FORMATE
CAS:557-41-5
Formula: C2H2O4Zn
155.42
ACM557415
FORMIC ACID ZINC SALT;caswellno915;epapesticidechemicalcode087802;zincdiformate;ZINC FORMATE;Zincformiat-2-hydrat;Bisformic acid zinc salt;Diformic acid zinc salt
ZINC GLUCONATE
CAS:4468-02-4
Formula: C12H22O14Zn
455.68
ACM4468024
bis(d-gluconato-o(1),o(2))-zin;bis(d-gluconato-o(sup1),o(sup2))-zin;bis(d-gluconato-o(sup1),o(sup2))zinc;bis(d-gluconato-o1,o2)-zin;bis(D-gluconato-?O1,?O2)-,(T-4)-Zinc;rubozine;Zinegluconate;ZINC GLUCONATE
ZINC HEXACYANOCOBALTATE
CAS:14049-79-7
Formula: C6CoN6.3/2Zn
ACM14049797
ZINC HEXAFLUOROACETYLACETONATE DIHYDRATE
CAS:16743-33-2
Formula: C10H6F12O6Zn
515.52
ACM16743332
ZINC HEXAFLUORO 2,4-PENTANEDIONATE;ZINC HEXAFLUOROACETYLACETONATE DIHYDRATE;Zinc hexafluoro 2,4-pentanedionate dihydrate;Zinchexafluoroacetylacetonatehydrate,min.98%;hexafluoroacetylacetone zinc derivative;Zinc hexafluoroacetylacetonate dihydrate 98%;Zinc
ZINC HEXAFLUOROACETYLACETONATE DIHYDRATE
CAS:16743-33-2
Formula: C10H6F12O6Zn
515.52
ACM16743332
ZINC HEXAFLUORO 2,4-PENTANEDIONATE;ZINC HEXAFLUOROACETYLACETONATE DIHYDRATE;Zinc hexafluoro 2,4-pentanedionate dihydrate;Zinchexafluoroacetylacetonatehydrate,min.98%;hexafluoroacetylacetone zinc derivative;Zinc hexafluoroacetylacetonate dihydrate 98%;Zinc
ZINC HYDROXIDE
CAS:20427-58-1
Formula: H2O2Zn
99.4
ACM20427581
zincdihydroxide;zinchydroxide(zn(oh)2);ZINC HYDROXIDE;znmc hydroxide;Zinc dihydoxide
ZINC IODIDE
CAS:10139-47-6
Formula: ZnI2
319.20
ACM10139476
ZINC IONOPHORE IV
CAS:358619-08-6
Formula: C21H33BKN6S3
516.64
ACM358619086
Zinc ionophore IV, [TmBut]K, Potassium hydrotris(N-tert-butyl-2-thioimidazolyl)borate, 358619-08-6
ZINC IRON OXIDE NANOPARTICLES / NANOPOWDER
CAS:12063-19-3
Formula: ZnFe2O4
241.08
ACM12063193
Iron zinc oxide nanopowder
ZINC IRON OXIDE NANOPARTICLES / NANOPOWDER
CAS:12063-19-3
Formula: ZnFe2O4
241.08
ACM12063193
Iron zinc oxide nanopowder
ZINC ISOPROPYL XANTHATE
CAS:1000-94-0
ACM1000940
ZINC ISOPROPYLSULFINATE
CAS:1416821-55-0
Formula: C6H14O4S2Zn;
279.674g/mol
ACM1416821550
zinc isopropylsulfinate;Zinc bis(isopropylsulfinate);SCHEMBL16344386;MFCD24386390;1416821-55-0;
ZINC LACTATE TRIHYDRATE
CAS:51120-75-3
Formula: C6H16O9Zn
297.58
ACM51120753
ZINC LACTATE TRIHYDRATE;ZINC DL-LACTATE TRIHYDRATE
ZINC MALATE
CAS:2847-05-4
Formula: C4H6O5.Zn
197.48
ACM2847054
Zinc 2-hydroxybutanedioate
ZINC MALEATE
CAS:7344-42-5
Formula: C4H2O4Zn
179.45
ACM7344425
MALEIC ACID, ZINC SALT
ZINC METHACRYLATE
CAS:13189-00-9
Formula: C8H10O4Zn
235.54
ACM13189009
Methacrylic acid zinc salt
ZINC METHANOLATE
CAS:1184-55-0
Formula: C2H6O2Zn
127.447840 [g/mol]
ACM1184550
1184-55-0, zinc;methanolate, Zinc methanolate, AGN-PC-000MP4, CTK4B0679, Methanol, zinc salt(8CI,9CI), EINECS 214-666-7, AG-D-40784, Zincmethoxide (6CI,7CI); Dimethoxyzinc; Zinc dimethoxide; Zinc methylate
ZINC METHOXIDE
127.46
ACM-00013789
ZINC MOLYBDATE
CAS:13767-32-3
Formula: MoO4Zn
225.33
ACM13767323
Molybdenumzincoxide;molybdenumzincoxide(mozno4);ZINC MOLYBDATE;ZINC MOLYBDENUM OXIDE;Zinc molybdenum oxide, 98% (Assay);molybdenum zinc tetraoxide;ZINC MOLYBDATE99.9+%;Zincmolybdate,98+%
ZINC N,N-DIMETHYLAMINOETHOXIDE
CAS:51223-30-4
Formula: C8H20N2O2Zn
241.65
ACM51223304
ZINC N,N-DIMETHYLAMINOETHOXIDE
ZINC N,N-DIMETHYLAMINOETHOXIDE
CAS:51223-30-4
Formula: C8H20N2O2Zn
241.65
ACM51223304
ZINC N,N-DIMETHYLAMINOETHOXIDE
ZINC N-PROPYLSULFINATE
CAS:24308-93-8
279.69
ACM24308938
ZINC NANOFOIL
65.37
ACM-00000034
ZINC NEODECANOATE
407.90
ACM-00013790
ZINC NEODECANOATE
CAS:27253-29-8
Formula: C20H38O4Zn
407.9
ACM27253298
ZINC NEODECANOATE;Neodecanoicacid,zincsalt;Zincneodecanoateinmineralspirits;Zinc neodecanoate, 40% in mineral spirits;Zinkneodecanoat;Zinc neodecanoate, Zn 17.9-18.2%;Zincneodecanoate,Zn;ZINC NEODECANOATE, tech-95
ZINC NEODECANOATE
CAS:27253-29-8
Formula: C20H38O4Zn
407.9
ACM27253298
ZINC NEODECANOATE;Neodecanoicacid,zincsalt;Zincneodecanoateinmineralspirits;Zinc neodecanoate, 40% in mineral spirits;Zinkneodecanoat;Zinc neodecanoate, Zn 17.9-18.2%;Zincneodecanoate,Zn;ZINC NEODECANOATE, tech-95
ZINC NEODECANOATE
Formula: C20H38O4Zn
407.9
ACM27253298
ZINC NEODECANOATE;Neodecanoicacid,zincsalt;Zincneodecanoateinmineralspirits;Zinc neodecanoate, 40% in mineral spirits;Zinkneodecanoat;Zinc neodecanoate, Zn 17.9-18.2%;Zincneodecanoate,Zn;ZINC NEODECANOATE, tech-95
ZINC NIOBATE97
CAS:12201-66-0
Formula: 2NbO3.Zn
347.196
ACM12201660
ZINC NIOBATE97
ZINC NIOBATE97
CAS:12201-66-0
Formula: 2NbO3.Zn
347.196
ACM12201660
ZINC NIOBATE97
ZINC NITRATE
CAS:13778-30-8
Formula: N2O6Zn
189.4
ACM13778308
ZN(NO3)2;ZINC ICP STANDARD, ZN(NO3)2;ZINC NITRATE HYDRATE, 99.999%;Zincnitrate(metalsbasis);Zinc nitrate hydrate, 99% (metals basis);Dinitric acid zinc salt hydrate;Zinc nitrate hydrate 99.999% trace metals basis
ZINC NITRATE HEXAHYDRATE
CAS:10196-18-6
Formula: Zn(NO3)2.6(H2O)
297.48
ACM10196186
ZINC NITRATE HYDRATE,99%(METALS BASIS)
CAS:10196-30-8
Formula: C5H13NO
103.16300
ACM10196308
2-amino-2,3-dimethyl-1-propanol; 2-amino-2-methyl-1-butanol; 2-amino-2-ethyl-1-propanol; 2-amino-2-ethylpropanol; 2-amino-2-methyl-butan-1-ol; 2-amino-2-methylbutanol; 1-Butanol,2-amino-2-methyl;
ZINC O,O,O',O'-TETRABUTYL BIS(PHOSPHORODITHIOATE)
CAS:6990-43-8
Formula: C8H19O2PS2.1/2Zn
548.06
ACM6990438
zinc O,O,O',O'-tetrabutyl bis(phosphorodithioate)ZBPD
ZINC OXALATE
CAS:547-68-2
Formula: C2O4Zn
153.41
ACM547682
ZINC OXALATE;ZINC OXALATE, 99.99+%;Zincoxalat-2-hydrat;zinc(II) oxalate;Zinc oxalate hydrate >=99.99% trace metals basis
ZINC OXALATE
CAS:547-68-2
Formula: C2O4Zn
153.41
ACM547682
ZINC OXALATE;ZINC OXALATE, 99.99+%;Zincoxalat-2-hydrat;zinc(II) oxalate;Zinc oxalate hydrate >=99.99% trace metals basis
ZINC OXIDE
CAS:1314-13-2
Formula: ZnO;ZnO;ZnO;OZn;
81.379g/mol
ACM1314132-1
Akro-zinc bar 85; Ozide; Zn 0701T; Blanc de Zinc; Zinc oxide, dispersion, nanoparticles, <110 nm particle size, 40 wt. % in butyl acetate; C-Weiss 8; Zinc oxide, Puratronic(R); Permanent White; Azo-55TT; Zinc oxide, p.a., 99.0%;
ZINC OXIDE NANOWIRES
CAS:1314-13-2
Formula: ZnO
81.37
ACM1314132
Oxozinc, Zinc White, Zinc monoxide, Zinci Oxydum, Flowers of zinc, Zincoid, Amalox, Ziradryl, Zincum, Oxydatum, Emanay zinc oxide, zinc, oxo-, Zinci Oxicum, Ketozinc, Nogenol, Permanent White
ZINC OXIDE SUBSTRATE, 10X10X0.5MM, POLISHED ONE SIDE, 0001 ORIENTATION
CAS:1314-13-2
ACM1314132-4
ZINC OXIDE SUBSTRATE, 10X10X0.5MM, POLISHED TWO SIDES, 0001 ORIENTATION
CAS:1314-13-2
Formula: ZnO
81.37
ACM1314132-3
Zinc monoxide
ZINC P-TOLUENESULFONATE HYDRATE
CAS:13438-45-4
Formula: C14H14O6S2Zn;
407.76g/mol
ACM13438454
EINECS 236-576-7; DTXSID8065456; Benzenesulfonic acid, 4-methyl-, zinc salt (2:1); CTK8D8438; zinc bis(4-methylbenzenesulfonate); 13438-45-4; Benzenesulfonic acid,4-methyl-, zinc salt, hydrate (2:1: ); Zinc di(toluene-4-sulphonate); YISPIDBWTUCKKH-UHFFFAO
ZINC PALMITATE
576.22
ACM-00000536
ZINC PENTAMETHYLENEDITHIOCARBAMATE
CAS:13878-54-1
Formula: C12H20N2S4Zn
385.95
ACM13878541
bis(1-piperidinecarbodithioato)-zin;bis(1-piperidinecarbodithioato-S,S')-,(T-4)-Zinc;bis(piperidinocarbodithioato)zinc;s')-bis(1-piperidinecarbodithioato-(beta-4)-zin;s')-bis(1-piperidinecarbodithioato-(t-4)-zin;vulkacitzp;vulkacitzpd;zincbis(piperidine-
ZINC PERCHLORATE
CAS:10025-64-6
Formula: Cl2H12O14Zn
372.38
ACM10025646
ZINC PERCHLORATE;ZINC PERCHLORATE 6H2O;ZINC PERCHLORATE HEXAHYDRATE;ZINC PERCHLORATE, HYDRATED;perchloricacid,zincsalt,hexahydrate;ZINC PERCHLORATE, HYDRATED REAGENT;Zincperchloratehexahydrate,99%;zinc perchlorate hexahydrate, reagent grade
ZINC PERCHLORATE
CAS:10025-64-6
Formula: Cl2H12O14Zn
372.38
ACM10025646
ZINC PERCHLORATE;ZINC PERCHLORATE 6H2O;ZINC PERCHLORATE HEXAHYDRATE;ZINC PERCHLORATE, HYDRATED;perchloricacid,zincsalt,hexahydrate;ZINC PERCHLORATE, HYDRATED REAGENT;Zincperchloratehexahydrate,99%;zinc perchlorate hexahydrate, reagent grade
ZINC PHOSPHATE
CAS:7790-90-0
ACM7790900
ZINC PHOSPHATE
CAS:7779-90-0
Formula: Zn3(PO4)2;O8P2Zn3;
386.08g/mol
ACM7779900
S577; Zinc Phosphate; Phosphoric acid, zinc salt (1: ); 14485-28-0; Trizinc diphosphate; UNII-1E2MCT2M62; trizinc; C.I. 77964; Delaphos; Trizinc phosphate;
ZINC PHOSPHATE, MONOBASIC
CAS:58968-26-6
Formula: H4O8P2Zn
259.36
ACM58968266
ZINC PHOSPHATE, MONOBASIC;ZINC PHOSPHATE, MONOBASIC 50% SOLUTION
ZINC PHOSPHATE, MONOBASIC
CAS:14485-28-0
Formula: H4O8P2Zn
259.36
ACM14485280
ZINC PHOSPHATE, MONOBASIC;zinc bis(dihydrogen phosphate);Phosphoric acid, zinc salt (2:1);Zinkbis(dihydrogenphosphat);phosphoric acid, zinc salt, dihydrate;ainc phosphate dibasic;C. I. Pigment White 32 (77964)
ZINC PHTHALOCYANINE
CAS:14320-04-8
Formula: C32H16N8Zn;
577.916g/mol
ACM14320048
14320-04-8; SR-01000883715-1; ZnPc; Zinc phthalocyanine, Dye content 97 %; C32H16N8zn;
ZINC PIVALATE
CAS:15827-10-8
Formula: C10H18O4Zn
267.63
ACM15827108
zinc:2,2-dimethylpropanoate
ZINC PIVALATE
CAS:15827-10-8
Formula: C10H18O4Zn
267.63
ACM15827108
zinc:2,2-dimethylpropanoate
ZINC PORPHYRIN DIMER
CAS:92995-45-4
Formula: C74H90N8Zn2
1222.320000 [g/mol]
ACM92995454
Bis(Zinc Porphyrin), AGN-PC-00QMU4, B3515, 92995-45-4, dizinc;2,3,7,8,12,13,17,18-octaethyl-5-[2-(2,3,7,8,12,13,17,18-octaethylporphyrin-21,22-diid-5-yl)ethyl]porphyrin-21,22-diide
ZINC PYRITHIONE
CAS:13463-41-7
Formula: C10H8N2O2S2Zn
317.7
ACM13463417
1-HYDROXY-2-PYRIDINE THIONE, ZN SALT;1-HYDROXYPYRIDINE-2-THIONE ZINC;1-HYDROXYPYRIDINE-2-THIONE ZINC SALT;2-PYRIDINETHIOL 1-OXIDE ZINC SALT;2-MERCAPTOPYRIDINE N-OXIDE ZINC;2-MERCAPTOPYRIDINE N-OXIDE ZINC SALT;2-mercaptopyridine-1-oxide zinc salt;MERCAPTOP
ZINC QUINOLIN-8-OLATE
CAS:1006-49-1
Formula: C18H12N2O2Zn
353.709 g/mol
ACM1006491
Zinc 8-quinolinolate, Bis(8-quinolinolato) zinc, 13978-85-3, zinc quinolin-8-olate, 8-Hydroxyquinoline zinc salt, Bis(8-hydroxyquinolinato)zinc, Caswell No. 924, zinc diquinolin-8-olate, SureCN296880, Zinc, bis(8-quinolinolato)-, Bis(8-quinolinolato)zinc(
ZINC SALICYLATE
CAS:16283-36-6
Formula: C14H10O6Zn
339.62
ACM16283366
bis(2-hydroxybenzoato-O1,O2)-,(T-4)-Zinc;o2)-bis(2-hydroxybenzoato-o(beta-4)-zin;Salicylicacid,zincsalt;Zinc,bis(2-hydroxybenzoato-O1,O2)-,(T-4)-;zincdisalicylate;ZINC SALICYLATE;ZINC SALICYLATE TRIHYDRATE;Zinc, bis2-(hydroxy-.kappa.O)benzoato-.kappa.O-,
ZINC SALICYLATE
CAS:16283-36-6
Formula: C14H10O6Zn
339.62
ACM16283366
bis(2-hydroxybenzoato-O1,O2)-,(T-4)-Zinc;o2)-bis(2-hydroxybenzoato-o(beta-4)-zin;Salicylicacid,zincsalt;Zinc,bis(2-hydroxybenzoato-O1,O2)-,(T-4)-;zincdisalicylate;ZINC SALICYLATE;ZINC SALICYLATE TRIHYDRATE;Zinc, bis2-(hydroxy-.kappa.O)benzoato-.kappa.O-,
ZINC SELENATE
CAS:13597-54-1
Formula: H2O4Se?Zn
208.346
ACM13597541
ZINC SELENATE;Zinc selenate pentahydrate;Selenic acid zinc salt
ZINC SELENIDE/ZINC SULFIDE QUANTUM DOTS
Formula: Zn-Se/ Zn-S
ACM-00000035
ZnSe/ZnS quantum dots, Zinc Selenide/Zinc Sulphide QDs, zinc selenide zinc sulfide alloyed quantum dogs, Bioconjugation Quantum Dots (ZnSe/ZnS-PEG-COOH Qds 410nm), Alloyed Quantum Dots, ZnSe/ZnS-MPA Quantum Dots 410nm, ZnSe/ZnS-PEG-NH2, Water s
ZINC SINGLE CRYSTAL DISC, 10MM (0.39IN) DIA, 2-3MM (0.08-0.1IN) THICK, (0001) ORIENTATION, 0.5
CAS:7440-66-6
ACM7440666
ZINC STANNATE
CAS:12027-96-2
Formula: H2O8Sn2Zn
432.82108
ACM12027962
ZincHydroxyStannate;Stannate (Sn(OH)62-), zinc (1:1), (OC-6-11)-;Zinc hexahydroxystannate
ZINC STEARATE
CAS:557-05-1
Formula: C36H70O4Zn;C36H70O4Zn;
632.332g/mol
ACM557051
Zinc distearate, pure; Zn Stearate; Zincum stearinicum; Stearates; Zink distearat; Octadecanoic acid, zinc salt; UNII-H92E6QA4FV; A830766; XOOUIPVCVHRTMJ-UHFFFAOYSA-L; Stearic acid, zinc salt;
ZINC SULFATE HEPTAHYDRATE
CAS:7446-20-0
Formula: ZnSO4. 7H2O;H14O11SZn;
287.541g/mol
ACM7446200
Zinc sulfate heptahydrate, 99.5%, for analysis; MFCD00149894; DTXSID0040175; zinc sulphate heptahydrate; AC1L1XHQ; Ophthazinc T (TN); UNII-N57JI2K7WP; Salt of Vitriol; UNII-89DS0H96TB component RZLVQBNCHSJZPX-UHFFFAOYSA-L; Sulfuric acid, zinc salt (1:1),
ZINC SULFIDE
CAS:1314-98-3
Formula: ZnS;ZnS;SZn;
97.44g/mol
ACM1314983
Zinc sulfide, pieces, 3-12 mm, 99.9% trace metals basis; Zinc sulphide; 12169-28-7; Cleartran; pigmentwhite7; EC 215-251-3; c.i.pigmentwhite7; Zinc blende; Albalith; Zinc sulfide, pellets, diam. x thickness 10 mm x 6.2 mm;
ZINC TELLURIDE
CAS:1315-11-3
Formula: TeZn
192.99
ACM1315113
ZINC TELLURIDE;zinctelluride(znte);Zinc telluride Coating Quality Balzers;Zinctelluridemetalsbasisgraypowder;ZINC TELLURIDE, -100 MESH, 99.99%;99.998%(metalsbasis);ZINC TELLURIDE, 99.999%;Zinctelluride(99.99%-Zn)PURATREM